KEGG   Sorangium cellulosum So ce56: sce0674Help
Entry
sce0674           CDS       T00634                                 

Gene name
ppgK
Definition
(GenBank) Polyphosphate-glucose phosphotransferase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
scl  Sorangium cellulosum So ce56
Pathway
scl00010  Glycolysis / Gluconeogenesis
scl00520  Amino sugar and nucleotide sugar metabolism
scl01100  Metabolic pathways
scl01110  Biosynthesis of secondary metabolites
scl01120  Microbial metabolism in diverse environments
scl01130  Biosynthesis of antibiotics
scl01200  Carbon metabolism
Module
scl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
scl_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:scl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    sce0674 (ppgK)
   00520 Amino sugar and nucleotide sugar metabolism
    sce0674 (ppgK)
Enzymes [BR:scl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     sce0674 (ppgK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: CAN90831
UniProt: A9EN87
Position
958796..959488
Genome map
AA seq 230 aa AA seqDB search
MRTLCIDIGGTGIKATILDEQGTPMTDPVRVPTPQPASPDPILDLIEEIARAQGEFDRVS
IGFPGVVMENVTKTAPHLDNEKWKGYPLGEAVERRLGKPVRVANDAGIQGLAVIEGKGLE
MVLTFGTGLGCALYIDGRYVPNLELGHHPYGKRDLKYEDRVFDAECKRIGPKRWNKRVRK
MIEQVEPIFNYRKLYLGGGNARLLDTSRLPENVVVVDNVAGLLGGIKLWA
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacgctttgtatcgatatcggcggaacggggatcaaggccaccatcctcgacgag
caggggactccgatgacggatcccgtgcgcgtgccgacgccccagccggcctcgccggac
cccatcctcgacctcatcgaggagatcgcccgggcgcagggggagttcgatcgcgtctcg
atcggcttccccggggtggtgatggagaacgtgaccaagacggcgccgcacctcgacaac
gagaagtggaagggttacccgctcggcgaggccgtcgagcgccgcctcggcaagcctgtc
cgcgtcgccaacgacgcgggcatccaggggctcgccgtcatcgagggcaaggggctcgag
atggtgctcaccttcggcacggggctcggctgcgcgctgtacatcgacggccgctacgtg
ccgaacctcgagctcgggcaccatccgtacggaaagagggacctgaagtacgaggaccgc
gtgttcgacgccgagtgcaagcgcatcggcccgaagcgctggaacaagcgcgtgcgcaag
atgatcgagcaggtcgagccgatcttcaattaccgcaagctctacctcggcggcggcaac
gcgcgcctgctcgatacctcgcggctgcccgagaacgtcgtcgtggtggacaacgtcgct
ggcctgctcggcggaatcaagctctgggcctag

DBGET integrated database retrieval system