KEGG   Sorangium cellulosum So ce 56: sce0787Help
Entry
sce0787           CDS       T00634                                 

Definition
hypothetical protein
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
scl  Sorangium cellulosum So ce 56
Brite
KEGG Orthology (KO) [BR:scl00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    sce0787
Enzymes [BR:scl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     sce0787
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1103196..1104926
Genome map
AA seq 576 aa AA seqDB search
MGSGDRLGHTPPREAGGMDFDVDFAIVGSGFGGSVSALRLTEKGYSVTVLECGKRWRKED
FPKTNWNVRKFLWAPRLLCHGIQRLTLLRDTLILSGAGVGGGSLVYANTLLVPPPEAFTS
PGWPAGTSWRDELMPFYELAKRMLGVTANPKLWPADRQLRQIADEMGRGDTFHVASVGVL
FAREGEQEGQRVPDPFFAGEGPDRATCVHCGGCMVGCRFGAKNTLDLNYLYLAEKKGCTI
QPETMVTAIDALPGGGYELTLERSTALLRKRRRTLRARAVVLSAGVLGTVKLLLKARAEG
RLPHLSPQLGHYVRTNSEVILGVTASDDRVDYSRGIAITSGIYPDARTHIEPVRYPAGSD
VMGALGTVLTDDAPGLPRWLRWLGRRLLHPIDLLSGLLPFRFARRSTILLVMQTLDNYMQ
LVWKRGGMTTRRPPDQPKPPAYIPVANEVGKRLAVLMDGTPRNAINEAVLNVPTTAHILG
GCAIADSPERGVIDQRNQVFGHDGLYVVDGSMVPANLGVNPSLTITAMAERAMSKMPPRR
DNPAFTGTSRMLEAAAPSKGQATIKSGCEANKIPCR
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
gtgggctctggagaccggctgggccatactccgcctcgagaagcgggtggcatggatttc
gacgtcgacttcgccatcgtgggttcgggcttcggcggcagcgtctccgcgctgcgcctc
accgagaagggctacagcgtcaccgtgctcgagtgcggcaagcgctggcgcaaggaggat
tttccgaagaccaactggaatgtacggaagttcctctgggcgcccaggctgctatgtcac
ggaattcagcggctgacgctgctcagggacacgctcatcctctcgggcgcgggcgtgggc
ggcggctcgctggtctacgccaacaccttgctggtgcccccgcccgaggccttcaccagc
cccggctggccggccggcaccagctggcgcgacgagctgatgcccttctacgagctcgcg
aagcgcatgctcggcgtgaccgcgaacccgaagctctggccggccgaccggcagctccgg
cagatcgccgacgagatgggccgaggcgacacgttccacgtcgccagcgtgggcgtcctc
ttcgcgagggagggcgagcaggaagggcagcgcgtgccagacccgttcttcgccggcgag
gggcccgatcgcgccacgtgcgtccactgcggcggatgcatggtgggctgccgcttcggc
gccaagaacacgctcgacctcaactacctttatctggccgagaagaagggctgtaccatc
cagcccgagacgatggtcaccgccatcgacgcgctcccgggcggcggctacgagctcacc
ctggagcgctccaccgcgctgctcaggaagcgccgccgcacgctccgggcgcgcgcggtg
gtgctcagcgccggcgtgctgggcacggtgaagctcctgctgaaggcgagggccgagggc
cggttaccccatctctccccgcagctcggccattacgtgcgcaccaacagcgaggtcatc
ctcggggtgacggccagcgacgatcgggtcgactactcccgcggcatcgcgatcacgagc
ggcatctaccccgacgcgcgcacgcacatcgagccggtgcgttaccccgccggctcggac
gtgatgggcgcgctgggcacggtgctcaccgacgacgcgccgggcttgccgcgctggctg
cgctggctggggcggcggctgctccacccgatcgacctgctctccgggctcctgccgttc
aggttcgcgaggcgctccacgatcctcctcgtgatgcagacgctggacaactacatgcag
ctcgtctggaaacgcggcggcatgacgacccgcaggccgcccgaccagccgaagccaccg
gcgtacatccccgtcgccaacgaggttggcaagcggctcgccgtgctgatggacggcacc
ccgcgcaacgccatcaacgaggccgtgctgaacgtcccgaccaccgcgcacatccttggc
ggctgcgccatcgccgacagcccggagcgcggggtgatcgaccagcgcaaccaggtgttc
ggccacgacggcctttacgtggtcgatggctcgatggtgcccgcgaacctgggcgtgaac
ccgtcgctcaccatcaccgccatggccgagcgggcgatgagcaagatgccaccgaggcgg
gacaacccggccttcaccgggacgtccagaatgctcgaggcggcggcgccctcgaaaggc
caggctacgataaaaagtggttgcgaggcgaacaaaattccttgtaggtag

DBGET integrated database retrieval system