KEGG   Sorangium cellulosum So ce 56: sce0968Help
Entry
sce0968           CDS       T00634                                 

Gene name
galM2
Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
scl  Sorangium cellulosum So ce 56
Pathway
scl00010  Glycolysis / Gluconeogenesis
scl00052  Galactose metabolism
scl01100  Metabolic pathways
scl01110  Biosynthesis of secondary metabolites
scl01120  Microbial metabolism in diverse environments
scl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:scl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    sce0968 (galM2)
   00052 Galactose metabolism
    sce0968 (galM2)
Enzymes [BR:scl01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     sce0968 (galM2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: CAN91125
UniProt: A9EUS1
Position
complement(1371527..1372774)
Genome map
AA seq 415 aa AA seqDB search
MGRTRSWFGLTMTACLTGACGGAHAVDTPPAAAPPAPPAAPATDAAPAAPAARSEPPGGE
AVNAKPASISKAPFGNADGKEVILYTLTNANGLVAKVMTYGATVTELHVPDKTGKMDDIV
LGHDNLDGYLKSSPYFGATVGRVANRIKNAQFQLDGKTYKLAANNGAHTLHGGKKGWDKV
VWDAEATETPDGPSITLTYVSKDGEEGYPGTVNATTTYTLTNKNELRVEMSATTDKTTIV
NMAHHGYWNLGGHGSGSVADQELTLHADSYTPPDATGVPSGQIKPVKGTPLDFTAAKPIG
RDLEAVGGKPVGYDHNMIVSGDPHKLREAARVKDPKTGRVLTIEADQPGIQFYTGNYLDG
SIKGKGGAVYGQYSGLCLEPQKFPNSINVPAWKNEVILKPGQRYAQTAVFRFTTE
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgggtaggacgagatcgtggttcggattgacgatgacggcgtgcctcaccggcgcgtgc
ggcggcgcgcacgccgtcgacacgccccctgcggcagcgccgcctgcgccgcctgcggcc
cccgcgacggacgccgctccagcggcccccgccgccagatccgagccacctggtggtgaa
gccgtgaacgcaaagcccgcttccatctccaaggcgcccttcggcaacgccgatggcaaa
gaggtgatcctctacacgctcacgaacgcgaacggcctggtcgcgaaggtgatgacctac
ggcgcgacggtgaccgagctccacgtccccgacaagacagggaagatggacgacatcgtc
ctcggccatgacaacctcgacggctacctgaagagcagcccctacttcggggcgacggtc
ggccgcgtggccaatcgcatcaagaacgcgcagttccagctcgatggcaagacctacaag
ctcgccgcgaacaacggggcccacacgctgcacggcggcaagaaaggctgggacaaggtc
gtctgggacgccgaagcgaccgagacgccggacggcccgtccatcacgctcacgtacgtg
tcgaaggatggggaagaaggataccccggcacggtcaacgcgaccacgacctacacgctc
accaacaaaaatgagctcagggtcgagatgtcggccacgaccgacaagaccacgatcgtc
aacatggcccaccacggctactggaacctgggagggcacggctcgggctccgtcgccgac
caggagctgacgctgcacgccgacagctacaccccgccggacgccaccggcgtcccctcg
ggccagatcaagccggtgaaggggacgccgctcgatttcaccgccgccaagccgatcggc
agggacctggaagccgtgggcggcaagccggtcggatacgaccacaacatgatcgtcagc
ggcgacccgcacaagctccgcgaggcggctcgggtcaaggatccgaagaccggtcgggtg
ctgacgatcgaggccgatcagccggggatccagttctatacgggcaactacctcgacggg
tcgatcaagggcaagggcggcgcggtctacggccagtacagcggcctgtgcctcgagccg
cagaagttcccgaactcgatcaacgtcccggcctggaagaacgaggtcatcctcaagccc
ggccagcgctacgcgcagacggccgtcttccggttcaccaccgagtag

DBGET integrated database retrieval system