KEGG   Sorangium cellulosum So ce56: sce1101Help
Entry
sce1101           CDS       T00634                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
scl  Sorangium cellulosum So ce56
Pathway
scl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
scl01100  Metabolic pathways
scl01110  Biosynthesis of secondary metabolites
scl01130  Biosynthesis of antibiotics
scl01230  Biosynthesis of amino acids
Module
scl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:scl00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    sce1101 (trpC)
Enzymes [BR:scl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     sce1101 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     sce1101 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C
Motif
Other DBs
NCBI-ProteinID: CAN91258
UniProt: A9F0C6
Position
1544349..1545830
Genome map
AA seq 493 aa AA seqDB search
MAEQGNVLARIVERKRADVAERERRTPLASLRASAPPTSRSLRRALSAPGARFVLECKKA
SPSEGLIRPDFDPHAVAAAYYGVADAVSVLTDEPFFQGSFEILQAVRAVVDVPILCKDFV
VTPYQVIEARANGADAILLMLSVLDDATALLCLGAAEALGMDCLVEVHDEAELERALALP
APVIGINNRDLKTLKVDLAVSERLAPRVPRDRIVIAESGVESRAHVERLAPSVDGFLVGT
SLMRSPDIADAARALVTGRVKICGLTRPGDAREAERLGARFGGLVFAETSPRRVTREQAE
IVVATAAGLPFVGVFLNQSVDFVADTARAIGLRAVQLHGDEDAAFIEALRRALPEGCEVW
KAVPMAPSGEAAGAAGAAGAGDDGAGAEVERSADRLVFDTRTAEARGGTGRTFAWSAIDG
HPARARSLLAGGLNPDNIAAARRVGTWGLDVASGVERAPGEKCADLLVRLFDSARGPSRH
DRDPAAPADRASP
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggctgagcagggcaatgtgctcgcgcgcatcgtggagcggaagcgggcggacgtggcg
gagcgcgagcggcggaccccgctcgccagccttcgggcgagcgcgccgcccacctcgcgg
agcctccggcgcgcgctctccgcgccgggcgcgcggttcgtcctggagtgcaagaaggcc
tccccgtccgagggcctcatccggcccgatttcgacccgcacgccgtcgccgccgcgtac
tacggcgtcgccgacgcggtgagcgtgctgaccgacgagcccttcttccagggcagcttc
gagatcctccaggccgtgcgcgcggtcgtggacgtcccgatcctctgcaaggacttcgtc
gtgacgccctaccaggtgatcgaggcgcgggcgaacggcgcggacgcgatcctgctcatg
ctgtcggtgctggacgacgcgaccgcgctcctctgcctgggcgccgccgaggcgctcggc
atggactgcctcgtcgaggtccacgacgaggcggagctcgagcgcgcgctcgcgctgccc
gcgcccgtgatcggcatcaacaaccgcgatctcaagacgctcaaggtcgatctcgccgtc
tcggagcggctcgccccgcgcgtgccgcgcgatcggatcgtcatcgcggagtcgggcgtc
gagtcgcgcgcccacgtggagcggctcgcgccctcggtggacgggttcctcgtcggcacg
tcgctcatgcgcagccccgacatcgcggacgccgcgcgcgcgctggtgaccggccgggtg
aagatctgcggcctgacccggcccggggacgcgcgcgaggcggagcggctcggggcccgc
ttcggcggcctcgtcttcgccgagacctcgccgcggcgggtgacgcgcgagcaggccgag
atcgtggtcgccacggccgcggggctgcccttcgtcggcgttttcctcaatcaatccgtg
gatttcgtcgcggatacggcgcgggcgatcgggctgcgcgccgtgcagctccacggcgac
gaggacgccgcgttcatcgaggcgctgcggcgcgcgctccccgaggggtgcgaggtctgg
aaggcggtcccgatggcgccgtccggggaggccgccggcgcggcgggcgccgcgggcgcg
ggcgacgacggcgcgggcgcggaggtcgagcgcagcgccgatcggctggtcttcgacacg
cgcacggcggaggcgcggggaggcacggggcggacgttcgcctggagcgcgatcgacggc
cacccggcgcgcgcccggagcctgctcgcgggcgggctgaacccggacaacatcgccgcg
gcgcgccgggtcgggacgtgggggctcgacgtggcgtcgggcgtcgagcgcgcgcccggc
gagaagtgcgccgacctgctcgtgcgcctgttcgacagcgcgcgcggcccgtcgcgccac
gaccgtgaccccgcggccccggcggaccgcgcctccccctga

DBGET integrated database retrieval system