KEGG   Sorangium cellulosum So ce 56: sce1101Help
Entry
sce1101           CDS       T00634                                 

Gene name
trpC
Definition
bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase (EC:5.3.1.24)
Orthology
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
scl  Sorangium cellulosum So ce 56
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:scl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    sce1101 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    sce1101 (trpC)
Enzymes [BR:scl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     sce1101 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     sce1101 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1544349..1545830
Genome map
AA seq 493 aa AA seqDB search
MAEQGNVLARIVERKRADVAERERRTPLASLRASAPPTSRSLRRALSAPGARFVLECKKA
SPSEGLIRPDFDPHAVAAAYYGVADAVSVLTDEPFFQGSFEILQAVRAVVDVPILCKDFV
VTPYQVIEARANGADAILLMLSVLDDATALLCLGAAEALGMDCLVEVHDEAELERALALP
APVIGINNRDLKTLKVDLAVSERLAPRVPRDRIVIAESGVESRAHVERLAPSVDGFLVGT
SLMRSPDIADAARALVTGRVKICGLTRPGDAREAERLGARFGGLVFAETSPRRVTREQAE
IVVATAAGLPFVGVFLNQSVDFVADTARAIGLRAVQLHGDEDAAFIEALRRALPEGCEVW
KAVPMAPSGEAAGAAGAAGAGDDGAGAEVERSADRLVFDTRTAEARGGTGRTFAWSAIDG
HPARARSLLAGGLNPDNIAAARRVGTWGLDVASGVERAPGEKCADLLVRLFDSARGPSRH
DRDPAAPADRASP
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggctgagcagggcaatgtgctcgcgcgcatcgtggagcggaagcgggcggacgtggcg
gagcgcgagcggcggaccccgctcgccagccttcgggcgagcgcgccgcccacctcgcgg
agcctccggcgcgcgctctccgcgccgggcgcgcggttcgtcctggagtgcaagaaggcc
tccccgtccgagggcctcatccggcccgatttcgacccgcacgccgtcgccgccgcgtac
tacggcgtcgccgacgcggtgagcgtgctgaccgacgagcccttcttccagggcagcttc
gagatcctccaggccgtgcgcgcggtcgtggacgtcccgatcctctgcaaggacttcgtc
gtgacgccctaccaggtgatcgaggcgcgggcgaacggcgcggacgcgatcctgctcatg
ctgtcggtgctggacgacgcgaccgcgctcctctgcctgggcgccgccgaggcgctcggc
atggactgcctcgtcgaggtccacgacgaggcggagctcgagcgcgcgctcgcgctgccc
gcgcccgtgatcggcatcaacaaccgcgatctcaagacgctcaaggtcgatctcgccgtc
tcggagcggctcgccccgcgcgtgccgcgcgatcggatcgtcatcgcggagtcgggcgtc
gagtcgcgcgcccacgtggagcggctcgcgccctcggtggacgggttcctcgtcggcacg
tcgctcatgcgcagccccgacatcgcggacgccgcgcgcgcgctggtgaccggccgggtg
aagatctgcggcctgacccggcccggggacgcgcgcgaggcggagcggctcggggcccgc
ttcggcggcctcgtcttcgccgagacctcgccgcggcgggtgacgcgcgagcaggccgag
atcgtggtcgccacggccgcggggctgcccttcgtcggcgttttcctcaatcaatccgtg
gatttcgtcgcggatacggcgcgggcgatcgggctgcgcgccgtgcagctccacggcgac
gaggacgccgcgttcatcgaggcgctgcggcgcgcgctccccgaggggtgcgaggtctgg
aaggcggtcccgatggcgccgtccggggaggccgccggcgcggcgggcgccgcgggcgcg
ggcgacgacggcgcgggcgcggaggtcgagcgcagcgccgatcggctggtcttcgacacg
cgcacggcggaggcgcggggaggcacggggcggacgttcgcctggagcgcgatcgacggc
cacccggcgcgcgcccggagcctgctcgcgggcgggctgaacccggacaacatcgccgcg
gcgcgccgggtcgggacgtgggggctcgacgtggcgtcgggcgtcgagcgcgcgcccggc
gagaagtgcgccgacctgctcgtgcgcctgttcgacagcgcgcgcggcccgtcgcgccac
gaccgtgaccccgcggccccggcggaccgcgcctccccctga

DBGET integrated database retrieval system