KEGG   Sorangium cellulosum So ce 56: sce1102Help
Entry
sce1102           CDS       T00634                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
scl  Sorangium cellulosum So ce 56
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:scl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    sce1102 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    sce1102 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    sce1102 (trpB)
Enzymes [BR:scl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     sce1102 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1545945..1547081
Genome map
AA seq 378 aa AA seqDB search
MPALEQLERAYLEARGDPSFAAEFDALLTTYAGRPTPLTLCRNLTGDPRVKLYLKREDLL
HGGAHKTNQALGQGLLARRMGKRRLIAETGAGQHGVATAMIGALLGMPTRIYMGAKDVER
QRLNVFRMRLMGAEVVPVTSGSQTLKDALNEALRYWTESYEDTHYLIGTVAGPHPFPTIV
RDFQWVIGREARAQILEAEGRLPDAVVACVGGGSNAMGIFSEFIPDKDVALVGVEPAGHG
LSTAMHGATLLKGRPGVLHGSETYILQDEHGQVAETHSVSAGLDYPGVGPEHAHLMTSGR
ATYVAATDDEALDAFQRLARSEGIIPAFESAHAIAHALKMVAEAAQAGRETVLVVNLSGR
GDKDMEQAQRLLDPGRST
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgcgctcgagcagctcgagcgcgcgtacctggaggcgcgcggcgatccgtcgttc
gcggcggagttcgacgccttgctgacgacctacgcggggcgaccgacgccgctcaccctg
tgccgcaacctgaccggcgatccgcgcgtgaagctgtacctcaagcgcgaggacctgctc
cacggcggggcgcacaagacgaaccaggcgctcggccaggggctgctcgcgcggcgcatg
ggcaagcggcggctcatcgccgagaccggggccggccagcacggcgtcgcgaccgccatg
atcggggccctgctcggcatgcccacgcgcatctacatgggcgcgaaggacgtcgagcgg
cagcggctcaacgtcttccggatgcgcctcatgggggccgaggtggtgcccgtgacctcg
ggctcgcagacgctgaaggacgccctcaacgaggcgctgcgctactggaccgagagctac
gaggacacgcattacctgatcgggacggtcgccgggcctcacccgttccccacgatcgtg
cgcgatttccagtgggtgatcggccgcgaggcgcgcgcccagatcctggaggccgagggg
cgcttgcccgacgcggtggtcgcgtgcgtgggcggcggcagcaacgccatggggatcttc
tccgagttcatcccggacaaggacgtggcgctcgtcggcgtggagcccgctggccacggc
ctgtcgaccgccatgcacggggcgacgctcctcaagggccgcccgggggtgctgcacggg
tcggagacctacatcctccaggacgagcacggacaggtcgccgagacgcactcggtctcg
gcggggctcgactaccccggcgtcgggccggagcacgcgcacctcatgacgtcgggccgg
gcgacgtacgtcgcggcgaccgacgacgaggcgctcgacgcgttccagcggctcgcgcgc
agcgagggcatcatcccggcgttcgagtcggcgcacgcgatcgcgcacgcgctgaagatg
gtggcggaggcggcgcaggcagggcgcgagacggtgctcgtcgtgaacctgtcgggccgc
ggagacaaggacatggagcaggcgcagaggctgctcgatcccgggaggtcgacatga

DBGET integrated database retrieval system