KEGG   Sorangium cellulosum So ce 56: sce1103Help
Entry
sce1103           CDS       T00634                                 

Gene name
trpA
Definition
hypothetical protein
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
scl  Sorangium cellulosum So ce 56
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:scl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    sce1103 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    sce1103 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    sce1103 (trpA)
Enzymes [BR:scl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     sce1103 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1547078..1547902
Genome map
AA seq 274 aa AA seqDB search
MSRETVTTRYDRAFERLRQRGEGAFIPFLMLGDPDLATSARLLRAAVEGGADAIEVGIPF
SDPIADGPTIQAAAVRALEAGVRPGDCIELLARFRAEAPEVPIGILTYANLVKHRDLAGF
YASAAAAGVDSVLVADVPVRESDPYVAAARAAGVAPVLIAPLNASEATLQRLAERCSAYT
YCVTRKGVTGADEQLRLGHGALFETLRRFGAPPAILGFGISKPEHVRDALAAGAFGVVSG
SAVVQRVAANVGDPEAAARAVASFVREMKAATAR
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgggagacggtgacgacgcgctacgatcgcgcattcgagcggctgcggcagcgc
ggcgagggggcgttcatccccttcctgatgctgggggatccggacctcgccacgagcgcg
cggctgctgcgcgcggccgtggagggcggcgcggacgcgatcgaggtcgggatcccgttc
tcggatccgatcgcggacggcccgacgatccaggccgccgccgtgcgggcgctcgaggcc
ggcgtgaggccgggcgactgcatcgagctcctggcgcggttccgggcggaggcgccggag
gtgccgatcggcatcctgacgtacgcgaacctcgtgaagcaccgcgatctggcgggcttc
tacgcgtcggcggccgcggccggggtcgacagcgtgctcgtcgccgacgtgccggtgagg
gagtcggatccgtacgtggcggcggcgcgcgccgcgggggtggcgccggtgctgatcgcg
ccgctgaacgcctcggaggccacgctgcagcggctcgcggagcggtgcagcgcgtacacg
tactgcgtgacgcgcaagggcgtgacgggggcggacgagcagctgcgcctgggccacggg
gcgctcttcgagacgctgcgccggttcggcgcgccgcccgcgatcctggggttcggcatc
tcgaagcccgagcacgtgcgcgacgccctcgccgccggggcgttcggcgtggtcagcggg
tccgcggtcgtgcagcgggtcgcggcgaacgtcggtgatcccgaggcggccgcgcgcgcc
gtcgcgagcttcgtgcgcgagatgaaggcggcgacggcgcgctga

DBGET integrated database retrieval system