KEGG   Sorangium cellulosum So ce 56: sce1179Help
Entry
sce1179           CDS       T00634                                 

Gene name
phoD
Definition
alkaline phosphatase (EC:3.1.4.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
scl  Sorangium cellulosum So ce 56
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:scl00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:scl00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:scl02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1632909..1634534
Genome map
AA seq 541 aa AA seqDB search
MSMARRSILCSVSMFSLAALPGLSGGWGAAPDGDAPLPASGDAPSPASEVSKTVFQHGVA
SGDPLPDAVILWTRVTAGKAGAVAVTWQIALDAGFTRIVGSGALLTDEERDHTVKVDAGG
LDPGKTYYYRFIALGGSSPVGRTRTAPRGRAGRLRFAVASCASYAHGLFHGYRHIAARLD
LDAVIHLGDYIYEFGAGQYGSARHYEPAHEIVTLADYRARYAQYRRDRDLQAAHQQHPFI
TVWDDHELANNTWKGGAGNHAWPAEGAWEERRAVAQRAYAEWMPIRERGEELRCAGRIWR
ALRYGDLVDLFLLDTRAWGRDRQADPGDRAAIEAPARTILGRDQEAWLRAELAGSTAAWK
VIGQQVLMGQLPQDLNTDAWDGYPAARQRFFELLDEERVRDVVVLSGDTHASWAIDLAPA
PLDPARYDAATGRGALAVEIAVPGITSPWLTEEQARAAEPLFLANPHVQYADLWRRGYAI
LDVTPERVQGAWFLYDAPERPQVDEVFAAAFAARRGESHLRREEAAALAIDDPPEAAPRV
S
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatggcccggcgaagcatcctttgcagcgtatccatgttcagcctcgctgcgctc
cccggattgtcgggcggctggggcgccgcgccggacggcgacgcgccgttgccggcgtcg
ggggacgctccgtcgccggccagcgaggtgtcgaagacggtattccagcacggcgtggcg
agcggggatccgctgcccgatgccgtcatcctctggacgcgcgtgacggcggggaaggcg
ggcgcggtggcggtgacatggcagatcgcgctcgacgccggcttcacgcggatcgtgggc
tcgggggcgctcctgacggacgaggagcgcgatcacacggtcaaggtcgacgccggcggg
ctcgacccagggaagacctattattaccggttcatcgccctcggcggatcgtcgcccgtc
gggcgcacgaggacggcgccgcgcggccgcgccgggcggctgcgcttcgccgtcgcgtcg
tgcgcgagttatgcgcacgggctgttccacgggtacaggcacatcgccgcgcgcctcgac
ctcgacgcggtgatccacctcggcgattacatctacgaattcggcgccggccagtacggg
agcgcgcggcattacgagccagcgcacgagatcgtgacgctcgccgactaccgcgcgcgt
tatgcccagtaccggcgcgacagggacctccaggcggcgcaccagcagcacccgttcatc
acggtctgggacgaccatgagctggcgaacaacacctggaagggcggcgcggggaaccac
gcgtggcctgccgagggggcgtgggaggagcgcagggcggtcgcgcagcgcgcctacgcg
gagtggatgccgatccgcgagcgcggcgaggagctgcgctgcgccggccggatctggcgc
gcgctgcgctacggcgatctcgtcgacctcttcctgctcgacacgcgcgcctgggggcgc
gaccggcaggccgacccgggcgatcgcgcggcgatcgaggcgccggcgcggacgatcctc
gggcgcgatcaggaggcgtggctgcgcgcggagctcgcgggctcgacggcggcgtggaag
gtcatcggtcaacaggtgctgatgggccagctcccgcaggacctgaacacggacgcgtgg
gacgggtatccggcggcgcgccagcgcttcttcgagctcctcgacgaggagcgcgtgcgc
gacgtcgtcgtgctcagcggcgacacccacgcgtcgtgggcgatcgatctcgcgccggcg
ccgctcgatccggcgcgctacgacgccgcgacgggccggggcgcgctggcggtcgagatc
gcggtgccggggatcacctccccgtggctcaccgaggagcaggcccgggcggccgagccg
ttgttcctcgcgaacccgcacgtccagtacgccgacctgtggcgccgcgggtacgcgatc
ctcgacgtgacgccggagcgcgtgcagggcgcgtggttcctgtacgatgcgcccgagcgc
ccgcaggtcgacgaggtgttcgccgcggcgttcgccgcgcgccgcggcgagagccacctg
cgccgcgaagaggcggcggcgctcgccatcgacgacccgcccgaggccgcgcctcgggtg
agctga

DBGET integrated database retrieval system