KEGG   Sorangium cellulosum So ce 56: sce1220Help
Entry
sce1220           CDS       T00634                                 

Definition
Xaa-His dipeptidase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
scl  Sorangium cellulosum So ce 56
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:scl01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:scl00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1688212..1690068
Genome map
AA seq 618 aa AA seqDB search
MRLSRLVHVGWIVVAALAYGACREDDASSPAPAAGAPACAHVDAELEASFHALARLVAAE
TYRAEQFANEDAFVASMQAIVDDLNAQAQQFNEGQRTHRIEPWEWKVESGNAAEPRYYWV
FGFRLGNGPRKISLNTHFDTVSPGDTDVWEPFVLTKSRGETKHGGEQELWVGRGAIDDKG
PALATFLVLKDIARAYDGSPLLDDITVELIFDTTEEIGAMSMRRYREENAGEAADLEIIF
DTFWAVRAEKGIERPVFTVPREAPPTAGVWIDSLNTPSGPVNQLPDRAEAILRGDSPAAL
EELALHIEADYADHPFDDPSYRRAELTVDTSGLPDALKLTTLVAGAQHASVPQENRANGA
NPLVSLTNFLGALAEEQVLADNDVARMCRFIKSTWGTKTFGETHPELLERHDEVFTEGNG
TTYALTRLYTEPSPGAITLHLDVRYAIGHHGQPWDGESEGLLCGDASEFAGIFGQIVDEF
NATSGGAPITFETVTRVAPDIRRVDGPTFSRISRAFEEVTGKPAPAVAMGAGTDAKAYVK
AIAAGALFDTTFGAPVNYHGIREAAPVRDLALSTKILCGVVEQEIKQAKEQHPEPVAGVC
EASSARKRSSAVDDGHDH
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atgaggttgagtagactggttcatgtgggctggattgtcgtcgccgcgctggcgtacggc
gcctgccgggaggacgatgcttcgagcccggcgcccgccgccggcgcgccggcctgcgct
cacgtcgacgccgagctcgaggcgagcttccacgcgctggccaggctggtcgccgccgag
acctaccgcgccgagcagttcgcgaacgaggacgcgttcgtcgcgagcatgcaggcgatc
gtcgatgacctgaacgcccaggcgcagcagttcaacgagggtcaaaggacccacaggatc
gagccgtgggagtggaaggtcgagagcggcaacgcggcggagcccaggtactactgggtc
ttcgggttccgtcttggcaatgggccccggaagatctccctgaacacgcacttcgatacg
gtgtctccgggggacaccgacgtgtgggagccgttcgtgctgacgaaatcgaggggcgag
accaagcacggcggcgagcaggagctgtgggtcggccgcggcgccatcgacgacaagggg
ccggcgctggcgacgttcctcgtgctcaaggacatcgcccgggcctacgacggcagtccc
ctgctcgacgacatcacggtggagctcatcttcgataccaccgaggagatcggcgccatg
tcgatgcggcgctaccgcgaggagaacgccggggaggcggcggacctcgagatcatcttc
gacacgttctgggccgtgcgcgcggagaagggcatcgagcgccccgtgttcacggtcccg
cgcgaggcgccgcccacggcgggcgtgtggatcgactcgctgaacaccccctccggcccc
gtcaaccagctccccgaccgggccgaggcgatcctccgcggcgattcacccgcggcgctc
gaggagctcgccctgcacatcgaggcggactacgccgatcatccgttcgacgatccgtcg
tacaggcgggccgagctcacggtcgacacgtccggcctgccggacgcgctcaagctgacg
accctggtggcgggcgcgcagcacgcgtccgtgccccaggagaaccgcgcgaacggcgcc
aatccgctcgtgtcgctcaccaatttcctgggcgcgctcgcggaggagcaggtcctcgcc
gacaacgacgtcgcccggatgtgcaggttcatcaagtccacctggggcacgaagacattc
ggggaaactcaccccgagctgctcgagcgccacgacgaggtgttcaccgagggcaacggc
accacctatgcgctgacccggctgtacaccgagccgtcgcccggggcgatcacgctccac
ctcgacgtccggtacgcgataggccaccacggccagccgtgggacggggagagcgagggg
ctcctttgcggagacgcgagcgagttcgccggtatcttcgggcagatcgtcgacgagttc
aacgccacctccggcggcgcgccgatcacgttcgagaccgtcacccgggtcgcgccggac
atccgccgggtcgacggccccaccttcagccggatcagccgcgcgttcgaggaggtgacc
ggcaagcccgcgcccgcggtggccatgggcgcgggcaccgacgccaaggcgtacgtgaag
gcgatcgccgcgggcgcgctgttcgacaccacgttcggcgccccggtcaattaccatgga
atcagggaggccgcgccggtccgcgatctcgcgctgagcaccaagatcctctgcggcgtc
gtcgaacaggagatcaagcaagcgaaggagcagcacccggagccggtggctggcgtgtgc
gaggcctcctctgcgcgcaagcgctcctccgccgtggacgacggccacgaccattga

DBGET integrated database retrieval system