KEGG   Sorangium cellulosum So ce 56: sce1599Help
Entry
sce1599           CDS       T00634                                 

Gene name
cheB
Definition
chemotaxis response regulator CheB type
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
scl  Sorangium cellulosum So ce 56
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:scl00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    sce1599 (cheB)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    sce1599 (cheB)
Enzymes [BR:scl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     sce1599 (cheB)
Two-component system [BR:scl02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   sce1599 (cheB)
Bacterial motility proteins [BR:scl02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    sce1599 (cheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2183609..2184691
Genome map
AA seq 360 aa AA seqDB search
MTFAPLRVLVVDDSAYNRRNIAEILSGSDEIEVVGKAGDGDDALRQAAQLRPDAITLDLE
MPRMDGFTFLRILMARQPTPVIIVSSYSHKENVFKALELGAVDFVAKPDRQFTADAQIRR
EIIQKVLLVRYLRPRSPMPAAPAPARPAQPASPRAVQESSRLGVSLRHLVAVGSSTGGPT
ALLEIFNRIPDRFPGAIFIAQHMPDKFTRTFAERLDRKGGLRVVEAQNGEQVVARKAYVC
PGRMCMEIAVTPGSGVGLSGDIRIRVGAPAPGDRYVPSADRLFRSVAQVGGSRAVGIILT
GMGDDGVNGARAVRAAGGTVVAESEDSAVVYGMPGAAVRAGVVNESLPFTAIGDFIALLS
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgacattcgctcccctgcgcgtgctcgtcgtcgacgactccgcgtacaaccggcgcaac
atcgccgagatcttgagcggaagcgacgagatcgaggtcgtgggcaaggccggtgacggc
gacgacgcgctccgtcaagccgcgcagctccggccggacgcgatcacgctggatctcgag
atgccgcgcatggacggattcaccttcctccgcatcctgatggcgaggcagccgacgccc
gtcatcatcgtctcgagctacagccacaaggagaacgtcttcaaggcgctcgagctgggc
gccgtcgacttcgtggccaagccggaccggcagttcacggcggacgcgcagatccggcgg
gagatcatccagaaggtcctgctggtgcgctacctccgcccccgctctccgatgcctgcc
gcgccggccccggcgcggccggcgcagcctgcgtcgccgcgcgcggtgcaggagtcgtcg
cggctcggcgtctcgctgcgccacctcgtggcggtcggctcgtcgacgggcgggcccacg
gcgctcctcgagatcttcaaccggatcccggatcgtttccccggcgcgatcttcatcgcg
cagcacatgccggacaagttcacccggacgttcgcggagcggctcgatcggaagggcggc
ctccgggtggtcgaggcgcagaacggcgagcaggtggtggcccggaaggcctatgtgtgc
ccgggtaggatgtgcatggagatcgcggtgacgccgggcagcggggtcgggctgagcggc
gacatccggatccgggtgggggcgccggcgcctggggatcggtacgttccgagcgcggac
cggctgttccggagcgtggcgcaggtgggcggcagccgcgcggtgggcatcatcttgacg
gggatgggcgacgacggggtgaacggcgcgcgggcggtccgcgcggccgggggcacggtg
gtggccgagagcgaggactcggcggtggtctacggcatgcccggggccgcggtgcgggcc
ggggtcgtgaacgagagcctgcccttcacggcgatcggcgatttcatcgcgctgctttcc
tga

DBGET integrated database retrieval system