KEGG   Sorangium cellulosum So ce 56: sce1660Help
Entry
sce1660           CDS       T00634                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate-2,6-diaminopimelate ligase, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate-L-lysine ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
scl  Sorangium cellulosum So ce 56
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:scl00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    sce1660 (murE)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    sce1660 (murE)
Enzymes [BR:scl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     sce1660 (murE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2273471..2275075
Genome map
AA seq 534 aa AA seqDB search
MTEHDHKEASLAEVELALRLGDVLREIPGAALSPAGAEDMVVTGVHLDSRKVGQGDIFVA
RAGARAHGERFIPEAVARGARAVIVARGSAADTLGAARVEVPDVPLALAQAAAVVYGHPT
FTLEVVGITGTNGKTTTAHLVQACIDRCGGQAGIVGTLGYRFGDLDVHASHTSPEADELA
RVAAAMVARGATHLVMEVSSIALAAKRVDAVRFRIAVFTNLTQDHLDYHGTMEAYAAAKA
RLFVDLGPGAAVINVDDPFGRQLVEMLAPGGLSRPTAATLARYSAEVGAGPDAAEIAPVE
LAHSASGTFIRARTPAGEVTIRSHLLGAHNASNLLAALAVAYLLGFDVGDAAAALSSPIQ
VAGRLERCDAPGADDVIVLVDYAHTPDALARVLASVRALGGGRVLCVFGCGGDRDPLKRP
QMGEAVGRVADVAIVTNDNPRSEDPRAIADAILPGLAAGRARVVVELDRARAIERAVLDA
EPGDVVLIAGKGHEPYQIIGGVTLPFDDRDEARRALAARRARALGERPSHGGAG
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgacggagcacgatcacaaggaagccagcctggccgaggtcgagctcgcgctccgcctc
ggcgacgtgctgcgcgagatcccgggcgccgcgctctctccggcgggcgccgaggacatg
gtcgtgacgggcgtgcacctcgactcgcgcaaggtggggcagggggacatcttcgtcgcg
cgcgcgggcgcgcgcgctcacggcgagcgcttcatccccgaggccgtggcgcgcggcgcg
cgggcggtgatcgtcgcccgcgggagcgcggccgacacgctcggcgccgcgcgcgtcgag
gtccccgacgtgccgctcgcgctcgcccaggccgccgccgtggtctacggacacccgacc
ttcacgctcgaggtcgtcggcatcaccggtacgaacggcaagacgacgacggcccacctc
gtccaggcctgcatcgatcggtgcggcggccaggccgggatcgtcgggacgctcggctac
cgcttcggcgatctcgatgtccacgcctcgcacacgagccccgaggcggacgagctcgcc
cgcgtcgccgccgcgatggtcgcccgcggcgcgacgcacctcgtgatggaggtgtcgtcg
atcgcgctcgcggcgaagcgcgtcgacgcggtccggttccggatcgccgtcttcacgaac
ctcacgcaggatcacctcgactaccacggcacgatggaggcgtacgcggcggcgaaggcg
cgcctgttcgtggatctcggccccggcgccgcggtcatcaacgtcgacgatcccttcggg
cggcagctcgtcgagatgctcgcccccggcgggctctcgcgcccgaccgcggcgacgctc
gcgcgctactcggcggaggtgggcgcgggcccggacgccgcggagatcgcccccgtcgag
ctcgcgcacagcgcgagcggcacgttcatccgcgcccgcacgcccgccggcgaggtcacc
atccgctcccacctgctcggcgcgcacaacgcgtccaacctgctcgccgccctcgccgtg
gcctacctgctcgggttcgacgtcggtgacgccgccgccgcgctctcgtctccgatccag
gtcgcgggccgcctggagcgctgtgatgcccccggcgccgacgacgtgatcgtgctcgtc
gactacgcgcacacgccggacgcgctggcccgcgtgctcgcgagcgtgcgcgccctcggc
ggcgggcgcgtcctctgcgtcttcgggtgcggcggcgaccgcgatccgctgaagcggccg
cagatgggcgaggcggtcggccgcgtcgccgacgtcgccatcgtcaccaacgacaacccg
cggagcgaggacccgcgcgcgatcgccgacgccatcctgccggggctcgccgccgggcgt
gcgcgcgtcgtcgtcgagctcgatcgggcgcgcgcgatcgagcgcgcggtgctcgacgcc
gagccgggcgacgtggtcctcatcgccggcaagggccacgagccgtaccagatcatcggc
ggcgtcacgctgccgttcgacgatcgcgacgaggcgcggcgcgcgctcgccgcgcggcgc
gcgcgcgccctcggcgagcggccgtcgcacggaggtgcggggtga

DBGET integrated database retrieval system