KEGG   Sorangium cellulosum So ce 56: sce1832Help
Entry
sce1832           CDS       T00634                                 

Gene name
srfJ
Definition
glucosylceramidase (EC:3.2.1.45)
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
scl  Sorangium cellulosum So ce 56
Pathway
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scl00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    sce1832 (srfJ)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    sce1832 (srfJ)
Enzymes [BR:scl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     sce1832 (srfJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2478165..2479820
Genome map
AA seq 551 aa AA seqDB search
MNRARGSTAGILLAFLLVGCGSSSGPEEPESSGGPGAGAGSSGSGSGNASSSGDASGSGD
ASGSGDASGTTGSGAGTGGSDGAGGDPGGDGGGGSSSGTGGGEPDVVEPTLITSGANEYW
KIGTPTEVTSGNADVTVDDAATQQRWDGFGGSFNEMGWNMLSMLGEAERQRAIKLLFDKN
EGAGFVYGRIPMGASDYAMDRYSLNEKKDDFTMESFSIARDKEKLIPYIKAALAVRPGLH
LWASPWTPPTWMKSNGAFDGGKMKDDANTLKAHALYFAKFVEAYAAEGMTIEAVHPQNEP
TYETRYPSCAWTGQLMAKFIGTHLGPLFEERGIKAQIFLGTMSNDAADPGILSAVTGDAT
AMKYVKGFGLQWNMRGSVNGLKSRNLPIVQTEHQCGNYNWNPPGVPVFNPDTAANDHAYG
QESWGLIRDWIKAGVNSYNAWNMVLDPVGKNIDSQRPWPQNALLNVKADTKELILTPAYY
VFRHVSQYVDPGAMRVNTTGGDALAFKNPDGSIVTVIYNSGSSAKTTTLGVAGKKLQFSV
PARGWATVNWK
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgaacagggcacgcggttcgaccgccggcatattgctcgcgtttctcctggtggggtgt
ggttcttcgagcggcccggaagaacccgagagctcgggcggcccgggtgcgggggcgggc
agcagcgggagcgggagcggaaacgcgagcagcagcggagacgcgagcgggagcggagac
gcgagcgggagcggagatgcgagcgggacgacaggcagcggcgcggggacgggcggttcg
gacggtgcgggcggcgatccgggcggagacggcggaggcggctcgtcttccggtaccggc
ggcggtgagcccgacgtggtcgaacccacgttgatcacctcgggcgcgaacgagtactgg
aagatcgggacgccgacggaagtgacgagcggcaatgccgacgtgaccgtcgacgacgcg
gcaacgcagcagcgttgggatggcttcggcggctccttcaacgagatgggctggaacatg
ctctcgatgctcggcgaggccgagcggcagcgagccatcaagcttctcttcgacaagaac
gagggcgcagggttcgtctacgggcgcatccccatgggggccagcgactatgcgatggac
cgctatagcctcaacgagaagaaagatgatttcacgatggagagcttctccatcgcgcgg
gacaaggagaaattgatcccgtacatcaaggcggcgctcgccgtgaggcccgggctccac
ctctgggccagcccctggacgccccccacctggatgaagagcaacggcgccttcgacggt
ggcaagatgaaggacgacgcgaacaccctgaaggcgcatgccctgtacttcgcgaagttc
gtggaggcgtacgccgcggagggcatgaccatcgaggcggtccacccccagaacgagccg
acctacgagacgaggtatccaagctgcgcgtggacggggcagctcatggcgaagttcatc
ggcacccacctggggccgctgttcgaagagcgcgggatcaaggctcagatcttcctcggc
acgatgtccaacgacgcggcggacccggggatcctcagcgccgtgaccggcgatgccacc
gcgatgaagtacgtcaagggcttcgggctgcagtggaacatgcggggcagcgtgaacggc
ttgaaatcgcgcaacctgccgatcgtgcaaacggagcaccagtgcggcaactacaactgg
aaccctccgggcgtgccggtgttcaacccggacacggcggcgaacgatcacgcctacggg
caggagagctgggggctcatccgcgactggatcaaggcgggggtgaactcgtacaacgcc
tggaacatggtgctggacccggtggggaagaacatcgactcgcagcggccgtggccccag
aacgcgctcctcaacgtgaaagccgacacgaaggagctgatactgacccctgcctactac
gtcttccgtcacgtctcgcagtacgtcgatcctggagcgatgcgcgtcaacacgaccggc
ggcgacgcgctggcgttcaagaacccggacggcagcatcgtcacggtcatctacaactcc
ggcagctccgcgaagacgaccaccctcggcgtggccggcaagaagctccagttcagcgtt
cctgcccgcggctgggccaccgtcaactggaagtga

DBGET integrated database retrieval system