KEGG   Sorangium cellulosum So ce 56: sce2188Help
Entry
sce2188           CDS       T00634                                 

Gene name
xysA
Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
scl  Sorangium cellulosum So ce 56
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2951700..2953049)
Genome map
AA seq 449 aa AA seqDB search
MRSAPLTLLLSAFLCAAGCSDSGDGDGGETTGSGGATGGTTTSGGSTTGSGATTGSGGGA
TTGSGGGATTGSGDPTSATSGATSGSGGGATTGSGTGGEGAGGSDGTGGGASARVPAASA
STLREAGEKANPPILIGAAISGGGLGNNDYKRVAAAEHNYVTAENEMKWDALEPSAGNFS
WGAADNIVNWARQNNMKVKGHTLVWHSQLPNWMSSMTGKANVEAAMRRHITQVMGHFKDR
LDHWDVVNEAVQTDSDTGVGNPRMRPTVFYNQIGESYIDLAFQIAREQDPKAKLYYNDYS
IDARNAKVDFVYNMIKGMVDRGVPIDGVGFQMHIGPPNNEATGADVAANLKRFTDLGLEV
LISEMDINRCGGVVTAEEQLTYYHDIVAACFKEPKCTAITFWGINDGRSWLNSWSGALCN
GQSSQSLLFNDQYGKKETYNRVMNALLGK
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgagatcagcacccttgacacttctcctctcggcattcctgtgtgcagccggctgctcg
gacagcggtgacggcgatggaggggagacgaccggcagcggcggcgcgacgggcggcacc
accaccagcggcggctcgacgaccggcagcggcgcgacgaccggcagcggcggcggcgcg
acgaccggcagcggcggcggcgcgacgaccggcagcggcgacccgacgagcgcgaccagc
ggcgcgacgagcggcagcggcggcggcgcgacgaccggcagcggcaccggcggcgagggc
gcgggcggcagcgatggtacgggcggcggcgccagcgccagagtccctgcggcgagcgcc
agcacgctgagggaggccggtgagaaggcgaaccccccgatactgatcggagcggccatc
tccggcggtggtctcggtaacaacgactacaagcgcgtcgccgccgccgagcacaactac
gtgacggcggagaacgagatgaagtgggacgcgctcgagcccagcgcgggcaatttcagc
tggggcgccgcggacaacatcgtgaactgggcgcgccagaacaacatgaaggtcaagggc
cacaccctggtgtggcacagccagctgcctaactggatgagctcgatgaccgggaaggcc
aacgtcgaggccgccatgcgcaggcacatcacccaggtcatggggcacttcaaggaccgg
ctcgatcactgggacgtcgtcaacgaggccgtccagaccgacagcgacaccggcgtcggc
aatccccgcatgaggcccacggtgttctacaaccagatcggggaatcgtacatcgacctc
gccttccagatcgcgagagagcaggatccgaaggccaagctttattacaacgattacagc
atcgacgcgcgcaacgcgaaggtcgacttcgtctacaacatgatcaaggggatggtcgat
cggggggtcccgatcgacggcgtcgggttccagatgcacatcggtccgccgaacaacgag
gccaccggagcggacgtggcggcgaacctgaagcgcttcaccgacctgggcctggaggtg
ctgatctccgagatggacatcaaccgctgcggcggcgtggtcacggcggaggagcagctc
acgtactaccacgacatcgtcgcggcctgcttcaaggagcccaagtgcacggccatcacc
ttctgggggatcaacgacggcaggtcgtggctcaacagctggagcggggcgctgtgcaac
gggcaaagctcgcagtcgctgctcttcaacgaccagtatgggaagaaggagacctacaac
agggtgatgaacgccctgctgggcaagtag

DBGET integrated database retrieval system