KEGG   Sorangium cellulosum So ce 56: sce2257Help
Entry
sce2257           CDS       T00634                                 

Gene name
pfp
Definition
diphosphate--fructose-6-phosphate 1-phosphotransferase (EC:2.7.1.90)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
scl  Sorangium cellulosum So ce 56
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:scl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    sce2257 (pfp)
   01230 Biosynthesis of amino acids
    sce2257 (pfp)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    sce2257 (pfp)
   00030 Pentose phosphate pathway
    sce2257 (pfp)
   00051 Fructose and mannose metabolism
    sce2257 (pfp)
   00052 Galactose metabolism
    sce2257 (pfp)
  Energy metabolism
   00680 Methane metabolism
    sce2257 (pfp)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    sce2257 (pfp)
Enzymes [BR:scl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     sce2257 (pfp)
Protein phosphatases and associated proteins [BR:scl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     sce2257 (pfp)
Messenger RNA biogenesis [BR:scl03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     sce2257 (pfp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3041542..3042861)
Genome map
AA seq 439 aa AA seqDB search
MVTPADLAIKDLGPCRHPSPVAEKLGEKATVYVGEADKVLFDDRLSAVLADASGARPPAF
ELAGPRNRVFWDPKEVRAGIVTCGGLCPGVNNVIRGLVLTMAQSYGVPEIFGFRYGYEGL
VARFGHAPMRLDPRSVEEIHRMGGTVLGTSRGNQDPHQMVDTLEALGINVLFVVGGDGTI
RGAMSLVRAIEERRLSIGVVGVPKTIDNDIKFIDRSFGFESAFAAAVDVIRSAHVEASGA
KNGIGLVKLMGRHSGFIACAAALASADVDVVLIPEVHAELDGPCGLLAHLERRLARHGNA
VIVVAEGAMQEHCTSSAEPMATDLSGNLKLKDIGLFLRDRINAHFRARGVEATLKYLDPS
YHIRSVPASPSDSVYCWNMARNAVHAAMAGNTEMLIGRWHGRFVHVPMPMAVRMRKQVDP
TDDLWMAVVEATGQPLSFC
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
gtggtgacccctgccgacctcgccatcaaggatctcggcccttgccggcacccctcgccc
gtcgccgagaagctcggcgagaaggccacggtgtacgtcggcgaggccgacaaggtgctg
ttcgacgatcgcctgtccgccgtcctcgcggacgcctccggcgcgcggccgccggcgttc
gagctggccgggccgcgcaaccgcgtcttctgggatccgaaggaggtgcgcgccggcatc
gtgacgtgcggcgggctctgccccggcgtcaacaacgtcatccgcggcctcgtgctcacg
atggcgcagagctatggcgtgccggagatcttcggcttccgctacggctacgaggggctc
gtcgcccgcttcgggcacgccccgatgcgcctggatccccgcagcgtcgaggagatccac
cgcatgggcggcaccgtgctcggcacctctcgcggcaaccaggacccgcaccagatggtg
gacacgctcgaggccctcggcatcaacgtcctcttcgtcgtcggcggcgacggcaccatc
cgcggcgcgatgtcgctcgtccgggccatcgaggagcgccgcctgtcgatcggggtcgtc
ggcgtgcccaagaccatcgacaacgacatcaagttcatcgaccgcagcttcggcttcgag
agcgccttcgccgccgccgtcgacgtcatccgcagcgcgcacgtggaggcctctggggcg
aagaacggcatcgggctcgtcaagctgatgggccgccactcgggcttcatcgcgtgcgcg
gcggcgctcgcgtcggcggacgtggacgtggtcctcatccccgaggtccacgcggagctc
gacggcccgtgcgggctgctcgcgcacctcgagcgccggctcgcccgccacggcaacgcc
gtgatcgtcgtcgccgagggcgccatgcaagaacactgcacctccagcgcggagcccatg
gcgacggatctcagcggcaacctcaagctgaaggacatcggcctcttcctgcgcgaccgc
atcaacgcgcacttccgggcgcgcggcgtcgaggcgacgctgaagtacctggacccgagc
tatcatatccgcagcgtccccgcgtccccgtcggacagcgtgtattgctggaacatggcc
cggaacgcggtccacgcggccatggcgggcaacaccgagatgctgatcggccggtggcac
ggccgcttcgtgcacgtgccgatgcccatggccgtccgcatgcgcaagcaggtggacccg
acggacgacctgtggatggccgtcgtggaggccacggggcagccgctctcgttctgctag

DBGET integrated database retrieval system