KEGG   Sorangium cellulosum So ce 56: sce2377Help
Entry
sce2377           CDS       T00634                                 

Gene name
malQ2
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
scl  Sorangium cellulosum So ce 56
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:scl00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3191100..3192752)
Genome map
AA seq 550 aa AA seqDB search
MSSPSAENQSQSSSSPSVPGSDARRRIAGVTVPLFSLRSDRSWGIGEIGDLPEFAAWMRA
AGLRLVQLLPLGEVSGGETSPYMALSAFGIDPMFISLSAVPELPAERLGEALGDDLGALD
RARNSARVDYDLVRRVKGRALRFAFDVFEREHHAKQTPRAAELGEFVKRQSDWLPDYAQF
RAFKDAFEGRAWWDWPEAIRERRPEALEALRRERARDILYYEYVQWLAHAQWEAARADLR
GKGVEIMGDLPFMVSRDSADVWAHQGEFRHDMTVGAPPDQFDTEGQRWGLPPYFWARMRE
NDFAWLRRRCRYTGLLYDRFRIDHLVGFYRTYIFPERGQAAQGAERPRATFDPAEEAEQR
EHGDRVVRAMLAGAAETGAQLVAEDLGAVPGWVRESLSELGVPGYKVLIWEKHDVVFRDP
AEYPALSVACFGTHDTDSVVVWWESRDDRERAGVLELPQLAPRRQELGPQFTKETHRALL
DLILGSKSELVLLLLQDVLATRDRINVPGTVGPQNWSLRLPAPPAALDRDPEVRAALDRV
RESIESSGRG
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccccctctgctgaaaatcagtcccagagctcatcgtcgccctccgttcccggt
tccgacgcgcgccgccgcatcgcgggcgtgacggtgccgctcttctccctgcgcagcgat
cgctcgtggggcatcggcgagatcggcgatctccccgagttcgccgcgtggatgcgcgcc
gcgggcctgcgcctcgtgcagctcttgccgctcggcgaggtgtcggggggcgagacgtcg
ccgtacatggcgctctccgcgttcgggatcgatccgatgttcatctcgctctccgccgtg
cccgagctcccggcggagcgcctcggcgaggcgctcggcgacgacctcggggcgctcgat
cgcgcgcggaacagcgcgcgcgtcgactacgatctcgtgcgccgcgtgaaggggcgggcg
ctgcgcttcgccttcgacgtgttcgagcgcgagcaccacgcgaagcagacgccgcgcgcg
gccgagctcggcgagttcgtgaagcggcagtcggactggctgcccgactacgcgcagttc
cgcgcgttcaaggacgccttcgagggcagggcgtggtgggactggcccgaggcgatccgc
gagcgcaggccggaggcgctcgaggcgctgcggcgcgagcgcgcgcgggacatcctctat
tacgagtacgtccagtggctcgcgcacgcgcagtgggaggcggcgcgcgcggatctccgg
ggcaagggcgtggagatcatgggggatctcccgttcatggtgtcgcgcgacagcgccgac
gtgtgggcgcaccagggcgagttccggcacgacatgacggtcggcgcgccgcccgaccag
ttcgacacggaggggcagcggtgggggctcccgccgtacttctgggcccggatgcgcgag
aacgacttcgcgtggctcaggcggcgctgccgctacacggggctgctctacgaccggttc
cgcatcgatcacctggtcggcttctaccggacgtacatcttcccggagcgagggcaagcg
gcccagggggccgagcggcccagggcgaccttcgatcccgcggaggaggcggagcagcgc
gagcacggcgatcgggtcgtgcgggcgatgctggcgggggcggcggagaccggggcgcag
ctcgtggcagaggatctcggcgcggtgccggggtgggtccgggagtcgctctcggagctc
ggggtgccgggctacaaggtgctgatctgggagaagcacgacgtcgtgttccgcgatccg
gcggagtatccggcgctctcggtggcctgcttcgggacgcacgacaccgactccgtggtc
gtgtggtgggagtcgcgggacgaccgggagcgcgccggggtcctcgagctgccgcagctc
gcgccgcgccggcaagagctcgggccgcagttcacgaaggagacccaccgcgcgctgctc
gacctgatcctcggctcgaagagcgagctcgtgctgctgctcctccaggacgtgctcgcc
acgcgcgatcggatcaacgtcccggggaccgtggggccgcagaactggtcgctccggctg
cccgcgccgcccgccgcgctcgatcgcgatcccgaggtgcgggccgcgctcgatcgggtg
cgcgagagcatcgagtccagcgggcgcggataa

DBGET integrated database retrieval system