KEGG   Sorangium cellulosum So ce 56: sce2662Help
Entry
sce2662           CDS       T00634                                 

Gene name
cheR4
Definition
chemotaxis response regulator (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
scl  Sorangium cellulosum So ce 56
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:scl02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:scl02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3602197..3603231
Genome map
AA seq 344 aa AA seqDB search
MRRPPVRVLVVDDSAFVRKVLRQVLGASSSIEVVDTAMDGFDALEKIARYKPDVVTLDLV
MPNLDGLGVLASLPREGAPRVIVVSSADADSDLGVRALQEGATDLVEKPTALATDRLFGL
ADELVRKVLAAAEAKVHRVEPPSAPPPAPFAIPALSRTRLVVIGASTGGPLALTRLLAAM
PAGFPAPIVVALHIPPGYTESLARRLDDGSALSIVEASDDLPLRPGLVVIARGGTHIEVR
RNLARASVCFPATAGASLYCPSVDLLFASAAAEFGPGVLGVVLTGMGDDGLEGSRAIRAA
GGKVLAEAESSCVVYGMPRRVLEAGLAAAAVPLDQMPAAILRHL
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgccccccggtccgcgtgctcgtggtcgacgactccgccttcgtgcgcaaggtg
ctgcggcaggtcctcggcgcgagctcctcgatcgaggtcgtcgacacggccatggacggc
ttcgacgcgctggagaagatcgcgcgctacaagccggatgtcgtcacgctggatctcgtg
atgccgaacctcgacggcctcggcgtgctcgcgtcgttgccgcgcgagggcgcgccgcgg
gtgatcgtcgtcagcagcgccgacgcggacagcgatctcggcgtcagggcgctccaggaa
ggcgcgaccgatctcgtcgagaagccgacggcgctcgcgaccgatcgcctcttcggcctc
gcggacgagctggtccgcaaggtgctcgccgccgccgaggcgaaggtccaccgcgtggag
ccgccgtccgcgccgccgcccgcgcctttcgctatcccggcgctgtcgcgcacgcggctc
gtcgtgatcggcgcctcgaccggcggcccgctggcgctgacgcggctcctcgcggcgatg
cccgccgggttcccggcccccatcgtcgtcgcgctgcacatccctcctggctacacggaa
tcgctggcgcgccgcctcgacgacgggagcgcgctctcgatcgtcgaggcgtcggacgat
ctcccgctccggcccgggctcgtggtcatcgcgcgcggggggacgcacatcgaggtccgg
cgcaacctggcgcgcgccagcgtctgcttcccggcgacggccggcgcgtccctctattgc
ccgtccgtggatctgctcttcgcgagcgccgcggccgagttcgggcccggcgtcctcggg
gtcgtgctcacgggcatgggggacgacggcctggagggctcccgggcgatccgcgcggcg
ggcgggaaggtcctcgcggaggccgagtcgtcctgcgtcgtttacggcatgccccgccgc
gtgctggaggccgggctcgccgcggccgcggtgcctctcgatcagatgcctgcggccatc
ctgcggcatctttga

DBGET integrated database retrieval system