KEGG   Sorangium cellulosum So ce 56: sce3087Help
Entry
sce3087           CDS       T00634                                 

Definition
hypothetical protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
scl  Sorangium cellulosum So ce 56
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:scl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    sce3087
   00052 Galactose metabolism
    sce3087
   00500 Starch and sucrose metabolism
    sce3087
   00520 Amino sugar and nucleotide sugar metabolism
    sce3087
Enzymes [BR:scl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     sce3087
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4228578..4229906
Genome map
AA seq 442 aa AA seqDB search
MELAISRRATRHQGATYDAFSAIRISGVCAGARCLSSRRRAHSEWRDRLHDAVATRIASW
SFEDTVSSLTQQIAALPGPLLARLRARGFDPDRVARWAASIGKDRDARNRLQGTVEPPAP
GDVADLPAEGTPEHARCREAGLAALRRGEVALCVLAGGMATRMGGVVKALVEVLPGRTFL
DLRLAESDHLRRTTGVPVPLWLMTSEATNGPIREALGPRLDEPGDLCATFEQHVSLRLTP
EGGLFLDEAGEPSVYATGHGDLPDALRESGLLGRFIARGGKIVWIANLDNLGATVDPVLL
GWHLGHGGPLSVEVVDKGGDKGGGPLRWNGRPVMAEDFRLPVGFDPKVVPVFNTNTFLAS
AEALSTLALDWIYVEVEKKVDDRKAIQFERILNEITFGLPARFVRVPREGLAARFLPVKD
VEELERRRPAIEAIARARGFLG
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggaactggcgatctccaggcgagcgacgcggcatcagggagccacgtacgacgcattc
agcgccatccggatctcgggtgtgtgcgcaggcgcgagatgcctctcaagcaggaggcgc
gcccattctgaatggcgtgaccggttgcacgatgccgttgccacgcgcatcgcctcgtgg
tcttttgaggataccgtgtcttccctcacccagcagatcgccgcgctccctggcccgctc
ctcgctcgcctccgggcccgcgggttcgaccccgatcgcgtcgcccggtgggccgcgtcc
atcggcaaggaccgggacgcccgcaaccgcctccagggcacggtcgagccgcccgcgccc
ggcgatgtcgccgacctgcccgccgagggcacgcccgagcacgcccgctgccgcgaggcg
ggcctggccgcgctgcgccggggcgaggtcgccctctgcgtcctcgccggcgggatggcc
acccggatgggcggcgtggtcaaggcgctcgtcgaggtgctgcccggtcggaccttcctc
gatctgcgcctcgccgagagcgatcacctccggcgcacgacgggggtcccggtcccgctg
tggttgatgaccagcgaggcgacgaatggaccgatccgcgaggcgctcggcccgcgcctc
gacgagccgggcgatctgtgcgccacgttcgagcagcacgtctcgctgcgcctgaccccg
gaaggcgggctgttcctggacgaggcgggcgagccgagcgtctacgccaccggccacggc
gatctcccggatgccctccgcgagagcggcctcctcggccgcttcatcgcccgcggcggg
aagatcgtctggatcgccaacctcgacaacctcggcgcgaccgtcgatccggtcctcctg
ggctggcacctcggccacggcgggcccctctccgtcgaggtggtcgacaagggcggcgac
aagggcggcgggccgctgcggtggaacggccgaccggtgatggcggaggacttccggctg
ccggtcgggttcgatccgaaggtcgtgcccgtcttcaacaccaacaccttcctggcgagc
gccgaggcgctcagcacgctcgcgctggactggatctatgtggaggtcgagaagaaggtg
gacgaccgcaaggcgatccagttcgagcgcatcctgaacgagatcacgttcgggctgccg
gcccggttcgttcgcgtgccgcgcgagggcctcgcggcccggttccttcccgtcaaggac
gtcgaggagctggagcggcggaggccggcgatcgaggcgatcgcccgcgcgcgcggcttc
ctcggctga

DBGET integrated database retrieval system