KEGG   Sorangium cellulosum So ce56: sce3822Help
Entry
sce3822           CDS       T00634                                 

Gene name
pyrB
Definition
(GenBank) Family membership
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
scl  Sorangium cellulosum So ce56
Pathway
scl00240  Pyrimidine metabolism
scl00250  Alanine, aspartate and glutamate metabolism
scl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scl00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    sce3822 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    sce3822 (pyrB)
Enzymes [BR:scl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     sce3822 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: CAN93982
UniProt: A9GWW0
Position
5318105..5319070
Genome map
AA seq 321 aa AA seqDB search
MRRIYPHRHLLGIEGLSRPEIVALLDAAESLFDVSRRSVRKVPTLRGKTVVNLFYEPSTR
TRTSFELAGKRLSADVINISVSTSSAVKGESLLDTVQNLQAMQPDVLVIRHAASGAPHHV
AAHTRAAVVNAGDGTHEHPTQALLDAFTIRRAKGRLEGLEVAICGDIVHSRVARSNAHLL
TTMGARVRFAGPRTLLPIAGESLGATVYDRIEPALEGADVVMMLRVQRERLSGSFLPSTR
EYSRTFGLNPARLALAKPDAIVMHPGPMNRGVEIDPRVADGAQSVILDQVEAGVAVRMAV
LWILAAEANEFSATGEPRPAP
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaggaggatctacccgcaccgacacctgctcggcatcgagggtctctcgcgtcccgag
atcgtggccctcctggacgccgccgagtcgctcttcgacgtctcccggcggagcgtgcgc
aaggtgcccacgctccgcggcaagacggtcgtgaacctcttctacgagccgtcgacgcgc
acgcggacgtcgttcgagctcgcgggaaagcggctcagcgccgacgtcatcaacatcagc
gtctccacctcgagcgcggtcaagggggaatcgctgctcgacacggtgcagaacctccag
gcgatgcagccggacgtgctggtcatccggcacgccgcgtcgggcgcgccgcaccacgtc
gccgcgcacacgcgcgccgcggtcgtcaacgcgggggacggcacgcacgagcacccgacg
caggcgctgctcgacgcgttcacgatccggcgcgccaagggccgactcgaagggctggag
gtcgccatctgcggcgacatcgtccacagccgcgtagcccgctcgaacgcgcacctgctc
acgacgatgggcgcgcgggtccgcttcgccggcccgcgcacgctcctgccgatcgcgggc
gagtcgctcggcgcgacggtctacgatcggatcgagcctgccctcgaaggggccgacgtg
gtgatgatgctgcgcgtgcagcgcgagcggctgagcggcagcttcctgcccagcacgcgc
gagtacagccgcacgttcgggctgaacccggcccggctcgcgctcgccaagccggacgcg
atcgtgatgcacccggggccgatgaaccgcggcgtggagatcgatccgcgcgtcgcggac
ggcgcgcagagcgtgatcctcgaccaggtcgaggccggcgtcgcggtcaggatggccgtg
ctctggatcctggccgcggaggccaacgagttctccgcgacgggcgagccacgccccgcg
ccctga

DBGET integrated database retrieval system