KEGG   Sorangium cellulosum So ce 56: sce4023Help
Entry
sce4023           CDS       T00634                                 

Definition
uricase (EC:1.7.3.3)
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
scl  Sorangium cellulosum So ce 56
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:scl00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    sce4023
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    sce4023
Enzymes [BR:scl01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     sce4023
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5601997..5602842)
Genome map
AA seq 281 aa AA seqDB search
MSISLVRNAYGKSRVRLVKVRRAGARHELTDVQVDVQLEGEFDDAYTKGDNSKVLPTDTM
KNTVYALAKGHPVEPIEDFGVLLAEHFLGKPHTRRARVAIAENVWSRVDAGGAPHPHAFL
RAAGERRTAEISAAPGGVEITSGIADLLVLKTTGSAFSGFPRDEHTTLKETGDRILSTLM
VARWRAAGRDPAPTATWERARRALIETFAERHSLSVQHTIHDLGEAVLAACPAIDEVSLS
LPNKHCLLVDLAPFGLTNDNEIFVPVDEPHGLIEATMKRGS
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatctcgttggtgcggaacgcctacggcaaatcgagggtgcggctcgtgaaggtc
cgccgcgcgggcgcgcggcacgagctcaccgacgtccaggtcgatgtccagctggagggc
gagttcgacgacgcttacacgaagggcgacaacagcaaggtgctgcccacggacacgatg
aagaacaccgtgtacgcgctcgccaagggccacccggtcgagcctatcgaggacttcggc
gtcctgctcgccgaacacttcctcggcaagccgcacacccggcgggcgagggtcgctatc
gcggagaacgtctggtctcgcgtcgacgcgggcggcgcgccgcaccctcacgccttcctc
cgcgcggcaggggagcggcggaccgcggagatctcggcggctcccggcggggtcgagatc
acgtccggcatcgcggacctcctcgtcctcaagaccaccggctcggcgttctctggcttc
ccgcgcgacgagcacacgacgctcaaggagaccggggaccgcatcctctcgacgctcatg
gtggcccgctggcgcgcggccggccgcgacccggcgccgacggcgacgtgggagcgcgcc
cgccgcgccctgatcgagacgttcgcggagcgacacagcctctcggtgcagcacaccatt
catgacctgggggaggcggtgctcgccgcctgtcctgccatcgacgaggtgagcctctcg
ctccccaacaagcactgcctgctcgtcgatctcgcacccttcgggctcaccaacgacaac
gagatcttcgtcccggtcgacgagccgcacgggctcatcgaggccacgatgaaacgaggg
agctga

DBGET integrated database retrieval system