KEGG   Sorangium cellulosum So ce 56: sce4102Help
Entry
sce4102           CDS       T00634                                 

Gene name
cga2
Definition
glucan 1,4-alpha-glucosidase (EC:3.2.1.3)
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
scl  Sorangium cellulosum So ce 56
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:scl00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5723943..5726321)
Genome map
AA seq 792 aa AA seqDB search
MDRALHTSRPTRCALLAGRSRSMRNLGRTLLVAALGGPLPLAGVASAATPTGAAPGSSSA
GSWSQGSKDLFGAAYESYDEDLKYSARSDTAPISNVWFTGASGILTEVFWPTNDTAQTRD
SQLLVTAAGRGLFEERRDARQSVRWIERGVPAFRVITEDPGGRFRIEKIVFADPDRDVVL
QRLKITRKVRGLRFFVLHNPSVGNTPLGDSAMASTGGAPGAGLFAWQGPFAQALVASVRW
RDATAGFSGAESDGYRDLQNHRTLTTHYRDARDGDVVLTGELDLPLSPGVCELTLALGFG
RDIDEAHRAAQASLREDPGALLDRYRAQWRAYQASLRPLGSASPDLARLYRSSVAVMKSL
EDRAHPGAFIASPSVPWGDVRLDRASALSPRTSGRITGGYHLVWPRDLSQIALALLAAGD
TRSPVAAMRFTKRIQLSASDGTWDFGPLHVSKDGSFYQNTWSDGEPYWRGLELDQVAQPI
DLCYHVVEERLVAADACWDLARRAADFLVAFGPWTPLDRWEEVSGVSPSTLAFVCAALAH
AAEIAGAMGDPAREARYRETAERWARQVDGWTFTTQGGTANGRYFVRVDGTGSPDAPRDP
NDERRYVLRGRSWLERDIVDCGFLRLVVLGVRPALAANIADSLAACDAALRVEVPGVGPG
FYRYVGDGYGFDPRTGERTRGMVWPLLTGERAEYELANALAKSSSPAAARKRMRPYLDAM
GRFATASQMLPEQVFDRGSRAGQPTGAAAPLGWAHAEFVLALREHDDAMLFRLPMSRAGG
ATRRDARGSSAP
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
atggaccgggcgttgcacacttccagaccgacgcgctgcgcgctcctcgctggtcggagc
cggtccatgcgaaatctcggaagaacgctgctggtcgcggcccttggcggcccgctcccg
ctcgccggcgtggccagcgccgcgacgcccaccggcgcggcgcctggatcctcgtccgcg
gggagctggtctcaaggctccaaggatctcttcggcgccgcatacgagagctacgacgag
gatctgaagtactcggcgcgctccgacacggccccgatcagcaacgtatggttcaccgga
gcgagcggcatcctgaccgaggtgttctggccgacgaacgataccgcgcagacgcgggac
agccagctgctcgtcacggcggccggcagaggcctcttcgaggagcggcgagacgcgcgg
cagagcgtccgctggatcgagcgcggcgtgccggctttccgggtgatcacggaagatccg
ggcggcaggttcagaatcgagaagatcgtcttcgccgatcccgatcgcgacgtggtcctg
cagcggctgaagatcacccggaaagtccgagggctcaggttcttcgtccttcacaacccc
agcgtggggaacacgccgctcggtgacagcgcgatggcgagcacgggaggcgcgccgggg
gcagggctcttcgcctggcaaggccccttcgcccaggccctcgtggcttccgtccgctgg
cgcgacgccacagccggcttctcgggcgccgagagcgacggctatcgggacctgcagaac
caccgcacgctgaccacccactaccgcgacgcgagggacggggacgtcgtgctgaccggg
gagctggatctcccgctctcgcccggggtctgtgagctcacgctggcgctcggcttcgga
cgcgacatcgacgaggcccaccgcgccgcccaggcgtcgctccgcgaggatcccggcgcg
ctcctcgacaggtaccgcgcccagtggcgcgcctatcaggcgtccctccgcccgctcggg
agcgcttcgcccgacctcgcgcgcctctaccggagctccgtggccgtgatgaagtccctc
gaggacagggcgcaccctggggccttcatcgcgtcgccgtccgtgccctggggcgacgtc
aggctcgaccgggcgagcgcgctctcgccgaggacctcgggcaggatcacgggcggttac
cacctcgtgtggccgcgcgatctcagccagatcgcgctcgcgctgctcgccgcgggcgac
acgcgctcgcccgtggccgcgatgcggttcacgaaacggatccagctctccgcgtcggac
ggcacctgggatttcggccctctccatgtctcgaaggacggttcattttaccagaacacc
tggtccgacggagagccgtactggaggggcctggagctcgatcaggtcgcgcagccgatc
gacctctgttatcacgtggtcgaggagcggctcgtcgcggcggatgcgtgctgggatctc
gcgcgccgcgccgccgacttcctcgtcgccttcggcccctggaccccgctcgatcgatgg
gaggaggtctcgggcgtctcgccgtcgaccctggccttcgtctgcgccgcgctcgcccat
gccgcggagatcgcgggcgcgatgggtgaccccgcgcgcgaggcccggtacagagagacg
gccgagcgctgggcccggcaggtcgacggctggacgttcaccacccaggggggcaccgcc
aacgggcggtatttcgtgcgcgtcgacgggaccggcagcccggacgccccgagggacccg
aacgacgagcgacgctatgtcttgcgtggccgctcctggctggagcgcgacatcgtcgat
tgcggcttcctcaggctcgtcgtcctcggggtgcgcccggcgctcgcggcgaacatcgcc
gattcgctggcggcctgcgacgccgcgctgcgcgtcgaggtccctggggtcggccccggg
ttctatcgctatgtcggcgacgggtatggcttcgacccgcgcacgggcgagcggacgaga
gggatggtgtggccgctgctcacaggcgagagagccgagtacgagctcgcgaacgcgctc
gcgaagtccagctcgccggcggcggcgcgcaagaggatgcgcccctacctcgacgcgatg
gggcgcttcgcgaccgcgtcccagatgttgccggagcaggtcttcgatcgcgggtcccgc
gccggccagccgaccggcgcggctgcgcccctcgggtgggcgcacgcggagttcgtcctg
gccctgcgcgagcacgacgacgcgatgctcttccgcctgccgatgagccgcgccggaggc
gccacccgacgggacgcgcgcggctcctccgctccgtga

DBGET integrated database retrieval system