KEGG   Sorangium cellulosum So ce 56: sce4292Help
Entry
sce4292           CDS       T00634                                 

Definition
beta-galactosidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
scl  Sorangium cellulosum So ce 56
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:scl00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    sce4292
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    sce4292
Enzymes [BR:scl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     sce4292
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6068266..6069381)
Genome map
AA seq 371 aa AA seqDB search
MRLDLELEVLCGQLIVGGFDGAEPPARYLKALAEGRRGGAILFRRNVPDVAATARLCQAL
AEAGGPDRPPFIGIDQEGGRVTRLPAPFLTLPSMRSLGELADLPLLRRAARAVASELRAV
GINLNFAPVLDVDSNPANPIIGDRAFGRDPGAVARGAVAFLEGLQEEGVLACGKHFPGHG
DTALDSHLALPTLSHARGRLDEIELPPFRAACGAGVASLMTAHIVVEALDPGVPATLSRA
ICTDLLRGEIGFEGVLFSDDLEMAAIAAHNAVEEAAAAAVWAGCDALLVCHSEDLQDRVH
EALVRKAEREPRFRERCAEAAARCLGLRRRCPPRPVSSPAAFAEIAGGPASRAVIEDIER
ARAARAAGAAT
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgcggctcgatctggagctcgaggtcctgtgtggtcagctcatcgtgggcggcttcgac
ggcgcggagccgccggcccggtacctgaaggccctcgccgaggggcggcggggcggcgcg
atcctgttccggcgcaacgtccctgacgtggccgccacggcgcggctctgccaggcgctc
gccgaggcgggcgggccagatcggcctcccttcatcggcatcgatcaggaggggggccgc
gtcacccgcttgcccgcgcctttcctgacgctgccgtcgatgcgctcgctcggcgagctc
gcggacctcccgctgctgcgccgcgcggcgcgcgccgtcgcgtccgagctccgggccgtc
ggcatcaacctgaacttcgccccggtgctcgacgtcgactcgaacccggcgaacccgatc
atcggcgatcgcgcgttcggccgcgaccctggcgcggtcgcgcggggcgccgtcgcgttc
ctggaggggctccaggaggagggcgtgctcgcctgcggcaagcacttcccggggcacggc
gacacggcgctcgacagccacctcgcgctcccgaccctctcgcacgcgcgcggccgcctc
gacgagatcgagctgccgccgttccgcgccgcctgcggcgccggggtcgcgtcgctcatg
acggcgcacatcgtcgtcgaggcgctcgatccgggcgtcccggcgacgctgtcgcgcgcc
atctgcaccgacctcctgcgcggcgagatcggcttcgagggggtgctcttctcggacgat
ctcgagatggccgcgatcgccgcgcacaacgcggtcgaggaggccgccgccgcggcggtc
tgggcgggctgcgacgcgctgctcgtctgccacagcgaggacctgcaggatcgcgtgcac
gaggcgctcgtgcgcaaggccgagcgcgagccccgcttccgcgagcgctgcgccgaggcg
gccgcgcggtgcctgggcctgcgccggcggtgcccgccgcggccggtctcgtcgcccgcg
gcgttcgccgagatcgccggcgggcccgcgtcccgggcggtgatcgaggacatcgagcgg
gcgcgcgccgcgcgcgccgcgggggcggcgacgtga

DBGET integrated database retrieval system