KEGG   Sorangium cellulosum So ce 56: sce4351Help
Entry
sce4351           CDS       T00634                                 

Gene name
glk
Definition
hypothetical protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
scl  Sorangium cellulosum So ce 56
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Butirosin and neomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:scl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    sce4351 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    sce4351 (glk)
   00052 Galactose metabolism
    sce4351 (glk)
   00500 Starch and sucrose metabolism
    sce4351 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    sce4351 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    sce4351 (glk)
   00524 Butirosin and neomycin biosynthesis
    sce4351 (glk)
Enzymes [BR:scl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     sce4351 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6148236..6149279
Genome map
AA seq 347 aa AA seqDB search
MARTNRSGAPSLLVGDIGGTNTRLALHGASGGRPLSEAVFRSRDHASFEEIALPFLVRSD
APHPAVAVLGVAGPIKDQVATVTNLPWRLAERELSRRLKIARVLLVNDLVVGATGCLHVA
RASIEPLTERRPRPKGNNMAVIAAGTGLGEARLLWNGARHVTLPTEGGHADFAARSAVEA
ELWQFLAERHPDHVSYERVLSGDGLGALFDFFARAARVPRAIERRLAEGDRNAAIAELGL
ARAFRPAARAVDLFVEIYGAEAGNLALRELALGGVFVLGNIARNLVPQRRELFMKSFVKK
GRLTPLLEEVPVAVITDPLVGVRGALAVARELAAAEQPRARAAARRS
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaggaccaacagatcgggggccccgtcgctgctcgtcggcgacatcggaggcacc
aacacccggctcgcgctccacggcgcctccggcggccggcccctctccgaggccgtcttc
cgcagccgcgaccacgcgagcttcgaggagatcgccctcccgttcctcgtgcgcagcgac
gcccctcaccccgccgtcgccgtgctcggcgtcgcgggccccatcaaggaccaggtcgcc
accgtcacgaacctgccctggcgcctcgcggagcgcgagctgtctcgccggctcaagatc
gcccgcgtgctcctggtgaacgacctcgtcgtcggcgccacgggctgcctgcacgtcgcc
cgcgcgtccatcgagccgctcacggagcgcaggccgcggccgaaggggaacaacatggcc
gtcatcgccgccggcacggggctcggcgaggcccggctcctctggaatggcgcccgccac
gtcacgctcccgaccgagggaggtcacgccgactttgccgcgcgctccgcggtcgaggcc
gagctgtggcagttcctcgccgagcgccacccggaccacgtgagctacgagcgggtcctc
tcgggcgacgggctcggcgccctcttcgacttcttcgcccgcgccgcccgcgtgccgcgc
gcgatcgagcgccgcctcgccgagggcgaccgcaacgcggcgatcgccgagctcgggctc
gcccgcgcgttccggcccgccgcgcgcgcggtcgacctgttcgtcgagatctacggcgcc
gaggccggcaacctcgccctgcgcgagctcgcgctcggcggggtcttcgtgctcgggaac
atcgcgaggaacctcgtcccccagaggcgcgagctgttcatgaagtccttcgtgaagaag
gggcgcctcacgccgctcctcgaggaggtgcccgtcgcggtgatcaccgatcccctggtc
ggcgtgcggggcgcgctcgccgtcgccagagagctcgccgccgcggagcagccccgggcc
cgcgcggcggcccggaggtcctga

DBGET integrated database retrieval system