KEGG   Sorangium cellulosum So ce56: sce4351Help
Entry
sce4351           CDS       T00634                                 

Gene name
glk
Definition
(GenBank) High confidence in function and specificity
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
scl  Sorangium cellulosum So ce56
Pathway
scl00010  Glycolysis / Gluconeogenesis
scl00052  Galactose metabolism
scl00500  Starch and sucrose metabolism
scl00520  Amino sugar and nucleotide sugar metabolism
scl00521  Streptomycin biosynthesis
scl00524  Neomycin, kanamycin and gentamicin biosynthesis
scl01100  Metabolic pathways
scl01110  Biosynthesis of secondary metabolites
scl01120  Microbial metabolism in diverse environments
scl01130  Biosynthesis of antibiotics
scl01200  Carbon metabolism
Module
scl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
scl_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:scl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    sce4351 (glk)
   00052 Galactose metabolism
    sce4351 (glk)
   00500 Starch and sucrose metabolism
    sce4351 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    sce4351 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    sce4351 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    sce4351 (glk)
Enzymes [BR:scl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     sce4351 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: CAN94514
UniProt: A9F2S1
Position
6148236..6149279
Genome map
AA seq 347 aa AA seqDB search
MARTNRSGAPSLLVGDIGGTNTRLALHGASGGRPLSEAVFRSRDHASFEEIALPFLVRSD
APHPAVAVLGVAGPIKDQVATVTNLPWRLAERELSRRLKIARVLLVNDLVVGATGCLHVA
RASIEPLTERRPRPKGNNMAVIAAGTGLGEARLLWNGARHVTLPTEGGHADFAARSAVEA
ELWQFLAERHPDHVSYERVLSGDGLGALFDFFARAARVPRAIERRLAEGDRNAAIAELGL
ARAFRPAARAVDLFVEIYGAEAGNLALRELALGGVFVLGNIARNLVPQRRELFMKSFVKK
GRLTPLLEEVPVAVITDPLVGVRGALAVARELAAAEQPRARAAARRS
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaggaccaacagatcgggggccccgtcgctgctcgtcggcgacatcggaggcacc
aacacccggctcgcgctccacggcgcctccggcggccggcccctctccgaggccgtcttc
cgcagccgcgaccacgcgagcttcgaggagatcgccctcccgttcctcgtgcgcagcgac
gcccctcaccccgccgtcgccgtgctcggcgtcgcgggccccatcaaggaccaggtcgcc
accgtcacgaacctgccctggcgcctcgcggagcgcgagctgtctcgccggctcaagatc
gcccgcgtgctcctggtgaacgacctcgtcgtcggcgccacgggctgcctgcacgtcgcc
cgcgcgtccatcgagccgctcacggagcgcaggccgcggccgaaggggaacaacatggcc
gtcatcgccgccggcacggggctcggcgaggcccggctcctctggaatggcgcccgccac
gtcacgctcccgaccgagggaggtcacgccgactttgccgcgcgctccgcggtcgaggcc
gagctgtggcagttcctcgccgagcgccacccggaccacgtgagctacgagcgggtcctc
tcgggcgacgggctcggcgccctcttcgacttcttcgcccgcgccgcccgcgtgccgcgc
gcgatcgagcgccgcctcgccgagggcgaccgcaacgcggcgatcgccgagctcgggctc
gcccgcgcgttccggcccgccgcgcgcgcggtcgacctgttcgtcgagatctacggcgcc
gaggccggcaacctcgccctgcgcgagctcgcgctcggcggggtcttcgtgctcgggaac
atcgcgaggaacctcgtcccccagaggcgcgagctgttcatgaagtccttcgtgaagaag
gggcgcctcacgccgctcctcgaggaggtgcccgtcgcggtgatcaccgatcccctggtc
ggcgtgcggggcgcgctcgccgtcgccagagagctcgccgccgcggagcagccccgggcc
cgcgcggcggcccggaggtcctga

DBGET integrated database retrieval system