KEGG   Sorangium cellulosum So ce56: sce4395Help
Entry
sce4395           CDS       T00634                                 

Definition
(GenBank) unnamed protein product; Family membership
  KO
K05396  D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
scl  Sorangium cellulosum So ce56
Pathway
scl00270  Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:scl00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    sce4395
Enzymes [BR:scl01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     sce4395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: CAN94558
UniProt: A9F383
Position
complement(6205850..6207025)
Genome map
AA seq 391 aa AA seqDB search
MADGEDEERAARAGAAGAAGPPGARLAVSPALPALPASRELPLFAELPELSGQVPWRPLA
HAPTPVVPCAAIEKYLGRGGVWVKRDDLISPLYGGNKVRRFEFLLADAERRGARTLVTVG
GLASTQVTATALFGRALGFAVTAVLFDQPITRFGRGALLADAASGAELVHGGGYATTAVR
AIRVLRRADRPYFILPGASSALPCLGYVDAMLELAAQVQRGEAPRPDRIVVPSGTGGTLA
GLTLGAAVLGWPTTIVGVRITERIASNRAVVRYEIGSMKRLLARRAPRFTRRRLPPVRFE
IDHRAIGPGYGMPTPASIAAIPEVERLIGVPGEVTYSAKALAALRGIAQERPRETLLLWQ
TLSSARPPLAEGGAAALPPAFARFFDGEIAY
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
gtggctgacggcgaggacgaggagcgagccgcccgcgccggggcggccggcgcggcgggg
cctcccggggcgcgtcttgccgtctcgcccgcgttgcccgcgttgcccgcgtcgcgggag
ctgccgctcttcgccgagctgcccgagctctcggggcaggtcccgtggcgccccctcgcg
cacgcgccgacgcctgtcgtcccgtgcgccgcgatcgagaagtacctcggccgcggcggc
gtctgggtcaagcgtgacgatctgatctcgccgctctacggcggcaacaaggtgcgtcgc
ttcgagttcctgctcgccgacgcggagcggcgcggggcgaggacgctcgtcaccgtcggc
gggctggcgtcgacgcaggtcaccgccacggccctcttcggccgcgcgctcggcttcgcc
gtcaccgcggtcctgttcgatcagccgatcacccggttcggccgcggcgcgctcctcgcc
gacgcggccagcggcgccgagctcgtccatggcggcgggtacgcgaccaccgcggtccgg
gcgatccgggtgctgcggcgggccgaccggccgtacttcatcctgccaggcgcctcgtcc
gccctcccgtgcctcggctacgtcgacgcgatgctcgagctcgcggcgcaggtccagcgc
ggcgaggccccccggcccgatcgcatcgtcgtcccctcggggacgggcggcacgctggcg
gggctcacgctgggcgccgcggtgctcggctggcccaccacgatcgtcggcgttcgcatc
accgagcgcatcgcgtcgaaccgcgccgtcgtccggtacgagatcggcagcatgaagcgc
ctgctcgcccggcgcgcgccgcgcttcacccggcgtcggctcccgccggtccgcttcgag
atcgatcaccgcgcgatcggccccggctacggcatgccgacccccgcgtccatcgcggca
atccccgaggtggagcggctgatcggtgtgccgggggaggtcacgtacagcgccaaggcg
ctcgccgcgctgcgcgggatcgcgcaggagcgcccgcgggagacgctcctcctctggcag
acgctctcgagcgcgcgaccgccgctcgcggagggcggcgcggcggcgctcccgccggcg
ttcgcgcggttcttcgacggggagatcgcgtactga

DBGET integrated database retrieval system