KEGG   Sorangium cellulosum So ce 56: sce4395Help
Entry
sce4395           CDS       T00634                                 

Definition
hypothetical protein
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
scl  Sorangium cellulosum So ce 56
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:scl00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6205850..6207025)
Genome map
AA seq 391 aa AA seqDB search
MADGEDEERAARAGAAGAAGPPGARLAVSPALPALPASRELPLFAELPELSGQVPWRPLA
HAPTPVVPCAAIEKYLGRGGVWVKRDDLISPLYGGNKVRRFEFLLADAERRGARTLVTVG
GLASTQVTATALFGRALGFAVTAVLFDQPITRFGRGALLADAASGAELVHGGGYATTAVR
AIRVLRRADRPYFILPGASSALPCLGYVDAMLELAAQVQRGEAPRPDRIVVPSGTGGTLA
GLTLGAAVLGWPTTIVGVRITERIASNRAVVRYEIGSMKRLLARRAPRFTRRRLPPVRFE
IDHRAIGPGYGMPTPASIAAIPEVERLIGVPGEVTYSAKALAALRGIAQERPRETLLLWQ
TLSSARPPLAEGGAAALPPAFARFFDGEIAY
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
gtggctgacggcgaggacgaggagcgagccgcccgcgccggggcggccggcgcggcgggg
cctcccggggcgcgtcttgccgtctcgcccgcgttgcccgcgttgcccgcgtcgcgggag
ctgccgctcttcgccgagctgcccgagctctcggggcaggtcccgtggcgccccctcgcg
cacgcgccgacgcctgtcgtcccgtgcgccgcgatcgagaagtacctcggccgcggcggc
gtctgggtcaagcgtgacgatctgatctcgccgctctacggcggcaacaaggtgcgtcgc
ttcgagttcctgctcgccgacgcggagcggcgcggggcgaggacgctcgtcaccgtcggc
gggctggcgtcgacgcaggtcaccgccacggccctcttcggccgcgcgctcggcttcgcc
gtcaccgcggtcctgttcgatcagccgatcacccggttcggccgcggcgcgctcctcgcc
gacgcggccagcggcgccgagctcgtccatggcggcgggtacgcgaccaccgcggtccgg
gcgatccgggtgctgcggcgggccgaccggccgtacttcatcctgccaggcgcctcgtcc
gccctcccgtgcctcggctacgtcgacgcgatgctcgagctcgcggcgcaggtccagcgc
ggcgaggccccccggcccgatcgcatcgtcgtcccctcggggacgggcggcacgctggcg
gggctcacgctgggcgccgcggtgctcggctggcccaccacgatcgtcggcgttcgcatc
accgagcgcatcgcgtcgaaccgcgccgtcgtccggtacgagatcggcagcatgaagcgc
ctgctcgcccggcgcgcgccgcgcttcacccggcgtcggctcccgccggtccgcttcgag
atcgatcaccgcgcgatcggccccggctacggcatgccgacccccgcgtccatcgcggca
atccccgaggtggagcggctgatcggtgtgccgggggaggtcacgtacagcgccaaggcg
ctcgccgcgctgcgcgggatcgcgcaggagcgcccgcgggagacgctcctcctctggcag
acgctctcgagcgcgcgaccgccgctcgcggagggcggcgcggcggcgctcccgccggcg
ttcgcgcggttcttcgacggggagatcgcgtactga

DBGET integrated database retrieval system