KEGG   Sorangium cellulosum So ce 56: sce4400Help
Entry
sce4400           CDS       T00634                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
scl  Sorangium cellulosum So ce 56
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:scl00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    sce4400
Enzymes [BR:scl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     sce4400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6211701..6212897
Genome map
AA seq 398 aa AA seqDB search
MCRRGSRSAGARRRVRRSTPARSGALRRALGRRRLALDDLVANRQRGRVSSSPLGFDPNG
PAIGNGIYGLPHTAEDARVVLVPVPWEPTVSYRRGAAKGPGAILRASRQVDLFDLHTGRP
YEQGIAMLDVDPDIVRWNAEACAAAEPVIAAHGEVAGDRDLEARLAAVNALSRRLNERVT
EIALRWMERGKLVGVIGGDHSSPYGAIAAHAAHYPGMGILHIDAHADLRNAYEGFTDSHA
SIMHNVATNHPTIPRIVQVGLRDMSEDELRFIRESNGRIVAHIDASIADRLFEGEPFHLI
ADSIVEDLPDDVYVSFDIDGLDPTLCPSTGTPVPGGLTFQQAVALIGRIQKSGRRIVGFD
LNEVAPKDDADDWDGNVGARLLYKLIGFTLLSHDTRNR
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
gtgtgcaggcgcgggagccgctccgccggtgctcggcggcgcgtgcggcggagcactccg
gcgcgctccggcgcgctccggcgtgcgctgggccggaggcggctcgcgcttgacgacctg
gtcgcgaaccgccaacgtggccgcgtgagctcatcccctctcggcttcgatccgaacggt
cccgccatcggcaacgggatttacgggctgccacacactgctgaggacgcccgggtggtc
ctcgtcccggtgccgtgggagccgacggtgtcctaccgccgcggcgccgccaagggcccg
ggggcgatcctgcgggccagccggcaggtcgacctcttcgacctgcacacgggcagaccg
tacgagcagggcatcgcgatgctcgacgtcgatccggacatcgtgcgctggaatgcggag
gcgtgcgccgcggccgagccggtgatcgcggcgcacggggaggtcgctggcgaccgggac
ctggaggcgcgcctcgcggcggtcaacgcgctctcccgccggctgaacgagcgcgtcacg
gagatcgccttgcgatggatggagcggggcaagctcgtcggcgtcatcggcggtgatcac
tcctccccctacggcgcgatcgcggcgcacgccgcgcattacccgggaatggggatcctg
cacatcgacgcgcacgccgatctacgcaacgcgtacgagggattcaccgactcccacgct
tcgatcatgcacaacgtcgcgacgaaccacccgacgatcccgcggatcgtccaggtcggg
ctgcgcgacatgagcgaagacgagctccggttcatccgcgagtcgaacgggcgcatcgtc
gcccacatcgatgcctcgatcgccgatcggctcttcgagggcgagccgttccacctgatc
gccgactcgatcgtggaggatctccccgacgacgtctatgtgagcttcgatatcgacggc
ctcgatccgacgctgtgtccgagcaccggcacgccagtccccggcgggctgacgttccag
caagccgtcgccctgatcggccgcatccagaagagcggccggcgcatcgtcggcttcgac
ctgaacgaggtcgcgccgaaggacgacgccgacgactgggacggcaacgtcggcgcccgc
ctcctctacaagctcatcggcttcacgcttctctcccacgacacgcgcaaccgttaa

DBGET integrated database retrieval system