KEGG   Sorangium cellulosum So ce 56: sce4410Help
Entry
sce4410           CDS       T00634                                 

Definition
hypothetical protein
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
scl  Sorangium cellulosum So ce 56
Pathway
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scl00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    sce4410
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    sce4410
Enzymes [BR:scl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     sce4410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6231607..6233955)
Genome map
AA seq 782 aa AA seqDB search
MATAASCGGGGSSSSSSDGGAGPGGAGAGTSTGAGAGTSQGPASSSSSGAGTGGAPPAVG
SGGSEGGGPPAHAPGEPISIPAQAWSRGITDGVYEDGAPIGGFGAGTITWRFDGRFYKGR
LDIGSNDQNVDNSAGFFMYQKAEGGDAQTKRLDKDGLGQGQATYSSLFPRSWVDYHGAAF
PCKAKVEQYSPIIPGDYKKTSYPVGVYRWEITNPTGAPCDVAVMLTWKNDHGGNGATVQT
SGDDVGLVLTRGGGAPSSEGQGEFTLASRNAPGVVVSYQSADSVAALQSELANDGALANT
TGGHSLGAIAFKATVEPGKSVIVPIVLAWDIPVTQAGSGDRWYRAYTRHFGRTGNASWTI
AAEALAEHEPWLWAIQDWQASVLDDPKYPEWLKGALFNELYYYAIAGTYWEAGAASGQPD
DPDEDMFTSLESYIYPFYGTSDVRFYGSWALFSLWPDIDKQEVRQFCDSVTTTRSDRPRA
IGTTAHDFGDNESVFRKWNAYTYRDSTNWKDLNSKLVLMVYRDWALTGKTDKAFLDYCWP
AVKMAMQKVKGQDGDGDGLPESNGIDQTYDDMDLHGNTAYCGGLFIAASEAAKELATAVG
DASLASTYQTWVEQSKGGFESKLWTGSYYKIDTGSRDTNRIMSDQLAGQWYARALGLPPI
VDPSHAASAFTKIYENNFKRFDGGTRGVVNVMTANGSVDGTSNQTRECWVGTSWGVVAGM
IQEGLAAQAGEIGASLVDTIWKTDGLWFRTPEAWEGNGSIRAPYYMRATTLWAAKHAYDI
AP
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
gtggcgacagccgcctcgtgcggtggaggtggctcgagctcgtcctcgtcggatggcgga
gcggggcctggcggcgccggtgccggaacatcgaccggagccggtgccggaacaagccag
ggccctgcgagcagctcgtcgtcaggggcgggcaccggcggcgctcctcccgcggtcggc
tccggcggcagcgaaggcggcggcccgccggcgcacgcgccgggcgagccgatctccatc
ccggctcaggcgtggagcaggggtatcacggacggcgtctacgaggacggcgcgcccatc
ggcggcttcggggccgggacgatcacctggcggttcgacggcaggttctacaagggtcgc
ctcgatatcgggagcaatgaccagaacgtcgacaacagcgcaggcttcttcatgtaccag
aaggccgaagggggcgacgcgcagacgaagcgcctcgacaaggacggcctgggccagggg
caggcgacgtactcctcgctctttccgcgctcgtgggtcgattaccacggggcggcattc
ccctgcaaagcgaaggtcgaacaatacagccccatcatcccgggcgactacaagaagacc
agctacccggtcggcgtttatcggtgggagatcacgaatccgaccggagcaccttgcgac
gtcgccgtgatgctgacctggaagaacgatcacggcggcaatggcgccacggtgcagacc
tccggcgacgacgtcggcctggtcctcacccgaggcggaggggcgccgagctccgaggga
cagggcgagttcacgctcgccagccggaacgcgccgggcgtggtcgtctcgtaccagtcc
gccgacagcgtcgccgccctgcagagcgagctcgccaacgacggagcgctcgccaacacg
acgggagggcactcgctcggggcgatcgcgttcaaggccacggtggagccggggaagagc
gtcattgtgccgatcgtgctcgcgtgggacatcccggtcacgcaggcgggctcgggcgac
aggtggtaccgcgcgtacacgcgccacttcgggcggacggggaacgcctcgtggacgatc
gcggcggaggcgctcgccgagcacgagccgtggctctgggcgatccaggactggcaggcg
agcgtgctcgacgacccgaagtacccggagtggctcaagggcgctctgttcaacgagctc
tattactacgccatcgcgggcacgtactgggaggccggggccgcgtccggccagccggac
gacccggacgaggacatgttcaccagcctcgagtcgtacatctacccgttctacgggacg
tcggacgtgcgcttttatggctcatgggccctgttctcgctctggccggacatcgacaag
caggaggtgcggcagttctgcgacagcgtgacgaccacccgctccgacaggccgcgcgcg
atcgggaccaccgcgcacgatttcggagacaacgagagcgtcttccgcaagtggaacgcg
tacacctaccgcgactcgaccaactggaaggatctcaactccaagctggtcctgatggtc
tatcgcgactgggcgctcaccgggaagaccgacaaggcgttcctcgattactgctggccc
gccgtgaagatggcgatgcagaaggtgaagggccaggacggcgacggggacgggctgccg
gagagcaacggcatcgatcagacctacgacgacatggatctgcacggcaacaccgcgtac
tgcggaggcctcttcattgccgccagcgaggccgcgaaggagctggcgaccgcggtcggt
gacgcctcgctcgcgagcacctaccagacgtgggtcgagcagtcgaagggcggcttcgag
tcgaagctctggacgggatcgtattacaagatcgacacggggagccgggacacgaaccgg
atcatgtcggaccagctcgctggccagtggtacgcgcgcgccctcgggctgccgccgatc
gtcgacccgagccacgccgcgtcggcgttcaccaagatctacgagaacaacttcaagcgg
ttcgacggcgggacccgcggcgtcgtcaacgtcatgaccgccaatggctcggtcgacggg
acgagcaaccagacgcgggagtgctgggtgggcacgtcctggggcgtggtggccggcatg
atccaggaggggctcgccgcgcaggccggcgagatcggcgcgagcctggtcgacacgatc
tggaagaccgacggcctgtggttccgcacgccggaggcatgggagggcaacggcagcatc
cgcgcgccctactacatgcgcgccaccacgctgtgggcggcgaagcacgcgtacgacatc
gcgccgtag

DBGET integrated database retrieval system