KEGG   Sorangium cellulosum So ce 56: sce4494Help
Entry
sce4494           CDS       T00634                                 

Gene name
glgB
Definition
1,4-alpha-glucan-branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
scl  Sorangium cellulosum So ce 56
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:scl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    sce4494 (glgB)
Enzymes [BR:scl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     sce4494 (glgB)
Exosome [BR:scl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   sce4494 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6337288..6339534)
Genome map
AA seq 748 aa AA seqDB search
MLEQRELDLIAAVEHPDPHHVLGAHEDEDDLVVRVFRPDATEIAVVPGDPRLRKQPMERV
HPAGLFEARFPGVSYPADGRFRYQLELRFPDGNSSVELDPYAMPPTLGDIDRHLLAEGRH
WELYRVLGAHVREVDGVSGTSFAVWAPNARRVSVLGDFNHWDGRRHAMRRMGEGFWEIFI
PGLGEGALYKYEIKTPEGNIAVKTDPVAQAMELRPATASRVYTSRYAFQDGDWMQERGRI
DSRKKPLTIYEVHAGSWRRVPGEGPPYEGGMRWMTYRELADHLVEYVAELGFTHIELMPV
MEHPFDGSWGYQVAGYFAPTSRFGDPDDLRYFIDRCHQRGIGVILDWTPAHFPKDAWALG
RFDGTALYEHLDPRLGEHREWNTYIFNYGRHEVRNFLVANALYWLDEFHIDGLRVDAVAS
MLYLDYAAQGGDWVPNRYGGRENIEAIDFIRELSNRVHERCPGAILCAEESTAWPSVTHA
TYVGGLGFDFKWNMGWMHDTLDFFKHEPIHRAFHYHQLTFGLIYAFSEKFLLPLSHDEVV
HLKRALLSKMPGDYWQMLANLRALYGYMWAHPGKKLLFMGGEIGQFAEWSEKTELDWGLL
SVPEHAGLKRLVTELNALYKKYPAMYELDDEHHGFRWIDCTDHMQTVISFIRYGDGAGDQ
MSPSGTHVVFIGNFTPVPRHPYRIGVPRRGAYLEVLNTDAVQYGGSGVGNLGRVEVEDVP
SHGFPQSIVLSLPPLGVLWLVPEQDAPG
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atgttggaacaacgagaactcgatctcatcgcggcagtcgagcatccggatccgcaccac
gtgctcggcgcgcacgaagacgaggacgacctggtggtccgcgtctttcggccggacgcc
accgagatcgcggtggtcccgggcgaccccaggctccggaagcagccgatggagcgcgtc
caccccgcgggcctcttcgaggcgcgcttccccggcgtgtcctaccccgcggacggacgc
ttccggtaccagctcgagctgcgcttccccgacggcaattcctcggtggagctcgacccg
tacgcgatgcctccgacgctcggggacatcgaccgccacctcctggccgaggggcggcac
tgggagctctaccgcgtcctcggcgcgcacgtgcgcgaggtggacggggtctccgggacg
tcgttcgcggtctgggccccgaacgcgcggcgggtgagcgtcctcggcgacttcaaccac
tgggacggccgccgccacgcgatgcgccggatgggcgagggcttctgggagatcttcatc
ccgggcctcggcgagggcgcgctctacaagtacgagatcaagacgccggaggggaacatc
gcggtgaagaccgatcccgtcgcccaggcgatggagctccggccggccaccgcctcgcgg
gtctacacgagccgctacgcgttccaggacggcgactggatgcaggagcgcggcaggatc
gactcgcgcaagaagccgctcacgatctacgaggtccacgccggctcctggcggcgcgtg
ccgggcgagggcccgccgtacgagggcgggatgcgctggatgacgtaccgcgagctcgcc
gaccacctcgtcgagtacgtggccgagctcggcttcacgcacatcgagctcatgccggtc
atggagcaccccttcgacggatcgtggggttaccaggtggcgggctacttcgccccgacc
agccgcttcggcgatcccgacgacctccgctacttcatcgatcgctgccaccagcggggg
atcggcgtgatcctcgactggacccccgcgcacttccccaaggacgcgtgggcgctcggg
cggttcgacggtacggcgctctacgagcacctcgacccgcgcctcggcgagcaccgcgag
tggaacacgtacatcttcaactacggccgccacgaggtgcggaacttccttgtggccaac
gcgctctactggctcgacgagttccacatcgacggcctgcgggtcgacgcggtcgcctcg
atgctctacctcgactacgccgcgcagggcggcgactgggtgccgaaccggtatggcggc
cgcgagaacatcgaggccatcgacttcatccgcgagctgtcgaaccgggtgcacgagcgc
tgtccgggcgcgatcctctgcgcggaggagtccaccgcctggccgtcggtgacccacgcg
acgtacgtcggcgggctcggcttcgacttcaagtggaacatggggtggatgcacgacacg
ctcgacttcttcaagcacgagcccatccaccgcgccttccactaccaccagctcacgttc
gggctgatctatgccttctccgagaagttcctcctgccgctgagccacgacgaggtcgtg
cacctcaagcgggcgctgctctcgaagatgcccggcgactactggcagatgctggcgaac
ctgcgcgcgctctacggctacatgtgggcgcacccgggcaagaagctgctcttcatgggc
ggtgagatcggccagttcgccgagtggagcgagaagacggagctcgactggggcctgctc
tcggtgcccgagcacgcggggctcaagcggctcgtgacggagctcaacgcgctctacaag
aagtatccggcgatgtacgagctcgacgacgagcaccacggcttccggtggatcgactgc
acggatcacatgcagaccgtgatctcgttcatccgctacggcgacggcgcgggagatcag
atgtcgccctcgggcacgcacgtcgtgttcatcggcaatttcacgccggtcccgcgccat
ccgtaccggatcggcgtcccgcggcgcggcgcctacctggaggtgctcaacaccgatgcg
gtccagtacggcggcagcggcgtgggcaacctgggtcgcgtcgaggtcgaggacgtcccg
agccacgggttcccgcaatccatcgtgctctcgctcccgccgctcggggtgctctggctc
gtccccgagcaggacgcgccgggctga

DBGET integrated database retrieval system