KEGG   Sorangium cellulosum So ce 56: sce4502Help
Entry
sce4502           CDS       T00634                                 

Gene name
pgm2
Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K15633  
2,3-bisphosphoglycerate-independent phosphoglycerate mutase [EC:5.4.2.12]
Organism
scl  Sorangium cellulosum So ce 56
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:scl01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:scl01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:scl00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:scl00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:scl00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6353522..6355180)
Genome map
AA seq 552 aa AA seqDB search
MSSLVLPKHRSFPGVSGPVVVVVMDGIGVGKHNDGNAVWLARTPHLDWLAVNAPSTTLAA
HGKAAGLPSDDDMGNSEVGHNALGAGRVFDQGAKLVNNAIADGSLFEGEAWRLAIARVKN
TGKPLHFMGLLSDGNVHSHIDHLAAMLKAADAVGVEKVRIHALIDGRDVPQTSALTYVER
IERELAAINGKGGRDYRVASGGGRMKITMDRYEADWPMVERGWRLHVRGEGRGFPSLEAA
IKTLREEDPAVIDQNLPGFVIVDGSGKPVGPIEDGSAVLFFNFRGDRAIEITRAFEDPHF
DKFDRGPKPDVFYAGMMQYDGDLQLPKRFLVPPPAIDRTLGEYLVAAGKRSYASSETQKY
GHVTYFWNGNRSGKFDDARETYFEVPSDTLPFEERPWMKASEITDALIAQLKSQKHDFYR
INYANGDMVGHTGVRDASIMAVEAVDLSIGRLLPVVKALNGVLLVTADHGNADEMYELVK
KTGAFETLADGSPKPKTSHTLNPVPFHVYAPGYTFAIDTTVQKPGLANMGATVLHLLGLS
APEDYLPSLIAG
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgagttcactggtcctccccaagcatcgctcgttccctggcgtgtccgggcccgtcgtc
gtcgtcgtcatggacggcatcggcgtcggcaagcacaacgacggcaacgcggtgtggctc
gctcgcaccccgcacctggactggctcgcggtcaacgcgccgagcaccacgctcgcggcg
cacggcaaggcggccggcctgccgagcgacgacgacatgggcaacagcgaggtcggccac
aacgcgctcggcgcgggccgcgtgttcgatcagggcgccaagctcgtgaacaatgccatc
gccgacggttcgctgttcgagggggaggcgtggaggctcgccatcgcgcgcgtgaagaac
acgggcaagccgctccacttcatgggcctgctctccgacggcaacgtgcacagccacatc
gaccacctggcggcgatgctcaaggccgcggacgcggtcggcgtcgagaaggtgcgcatc
catgcgctgatcgacgggcgcgacgtgccgcagaccagcgcgctcacctacgtggagcgg
atcgagcgggagctcgccgcgatcaacggcaagggcggtcgcgactaccgcgtggcctcc
ggcggtggccgcatgaagatcaccatggatcgctacgaggctgactggcccatggtcgag
cgcggctggagactccacgtgcgcggcgaggggcgtggtttcccgagcctcgaggcggcg
atcaagacgctgcgcgaggaagacccggccgtcatcgaccagaacctgcccggcttcgtg
atcgtcgacggcagcggcaagcccgtggggcccatcgaggatggctcggcggtgctcttc
ttcaacttccgcggcgaccgcgcgatcgagatcacgcgcgcgttcgaagacccccacttc
gacaagttcgaccgcggcccgaagccggacgtcttctacgcgggcatgatgcagtacgac
ggcgatctccagcttccgaagcgcttcctcgtgcctccaccggccatcgaccgcacgctc
ggcgagtacctcgtcgcggccggcaagcgcagctacgccagcagcgagacgcagaagtac
ggccacgtgacctacttctggaacggcaaccggagcggcaagttcgacgacgcgcgggag
acctacttcgaggtgccgagcgacacgctgcccttcgaggagcgcccgtggatgaaggcg
tcggagatcaccgacgcgctcatcgcccagctcaagagccaaaagcacgacttctaccgg
atcaactacgcgaacggcgatatggtgggccacacgggcgtccgcgacgcgtccatcatg
gccgtcgaagcggtcgacctctcgatcgggcgcctgctcccggtggtcaaggcgctgaac
ggcgtgctcctcgtcacggccgaccacggcaacgccgacgagatgtacgagctcgtgaag
aagaccggcgccttcgagacgctcgcggacggctcgccgaagccgaagacgagccacacg
ctcaacccggtgccgttccacgtctatgcgcccggctacacgttcgcgatcgacaccacc
gtgcagaagcccggcctcgcgaacatgggggccaccgtgctccacctcctgggcctcagc
gctccggaggactacctcccgtcgctgatcgctggctga

DBGET integrated database retrieval system