KEGG   Sorangium cellulosum So ce 56: sce4502Help
Entry
sce4502           CDS       T00634                                 

Gene name
pgm2
Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K15633  
2,3-bisphosphoglycerate-independent phosphoglycerate mutase [EC:5.4.2.12]
Organism
scl  Sorangium cellulosum So ce 56
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:scl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    sce4502 (pgm2)
   01230 Biosynthesis of amino acids
    sce4502 (pgm2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    sce4502 (pgm2)
  Energy metabolism
   00680 Methane metabolism
    sce4502 (pgm2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    sce4502 (pgm2)
Enzymes [BR:scl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     sce4502 (pgm2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6353522..6355180)
Genome map
AA seq 552 aa AA seqDB search
MSSLVLPKHRSFPGVSGPVVVVVMDGIGVGKHNDGNAVWLARTPHLDWLAVNAPSTTLAA
HGKAAGLPSDDDMGNSEVGHNALGAGRVFDQGAKLVNNAIADGSLFEGEAWRLAIARVKN
TGKPLHFMGLLSDGNVHSHIDHLAAMLKAADAVGVEKVRIHALIDGRDVPQTSALTYVER
IERELAAINGKGGRDYRVASGGGRMKITMDRYEADWPMVERGWRLHVRGEGRGFPSLEAA
IKTLREEDPAVIDQNLPGFVIVDGSGKPVGPIEDGSAVLFFNFRGDRAIEITRAFEDPHF
DKFDRGPKPDVFYAGMMQYDGDLQLPKRFLVPPPAIDRTLGEYLVAAGKRSYASSETQKY
GHVTYFWNGNRSGKFDDARETYFEVPSDTLPFEERPWMKASEITDALIAQLKSQKHDFYR
INYANGDMVGHTGVRDASIMAVEAVDLSIGRLLPVVKALNGVLLVTADHGNADEMYELVK
KTGAFETLADGSPKPKTSHTLNPVPFHVYAPGYTFAIDTTVQKPGLANMGATVLHLLGLS
APEDYLPSLIAG
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgagttcactggtcctccccaagcatcgctcgttccctggcgtgtccgggcccgtcgtc
gtcgtcgtcatggacggcatcggcgtcggcaagcacaacgacggcaacgcggtgtggctc
gctcgcaccccgcacctggactggctcgcggtcaacgcgccgagcaccacgctcgcggcg
cacggcaaggcggccggcctgccgagcgacgacgacatgggcaacagcgaggtcggccac
aacgcgctcggcgcgggccgcgtgttcgatcagggcgccaagctcgtgaacaatgccatc
gccgacggttcgctgttcgagggggaggcgtggaggctcgccatcgcgcgcgtgaagaac
acgggcaagccgctccacttcatgggcctgctctccgacggcaacgtgcacagccacatc
gaccacctggcggcgatgctcaaggccgcggacgcggtcggcgtcgagaaggtgcgcatc
catgcgctgatcgacgggcgcgacgtgccgcagaccagcgcgctcacctacgtggagcgg
atcgagcgggagctcgccgcgatcaacggcaagggcggtcgcgactaccgcgtggcctcc
ggcggtggccgcatgaagatcaccatggatcgctacgaggctgactggcccatggtcgag
cgcggctggagactccacgtgcgcggcgaggggcgtggtttcccgagcctcgaggcggcg
atcaagacgctgcgcgaggaagacccggccgtcatcgaccagaacctgcccggcttcgtg
atcgtcgacggcagcggcaagcccgtggggcccatcgaggatggctcggcggtgctcttc
ttcaacttccgcggcgaccgcgcgatcgagatcacgcgcgcgttcgaagacccccacttc
gacaagttcgaccgcggcccgaagccggacgtcttctacgcgggcatgatgcagtacgac
ggcgatctccagcttccgaagcgcttcctcgtgcctccaccggccatcgaccgcacgctc
ggcgagtacctcgtcgcggccggcaagcgcagctacgccagcagcgagacgcagaagtac
ggccacgtgacctacttctggaacggcaaccggagcggcaagttcgacgacgcgcgggag
acctacttcgaggtgccgagcgacacgctgcccttcgaggagcgcccgtggatgaaggcg
tcggagatcaccgacgcgctcatcgcccagctcaagagccaaaagcacgacttctaccgg
atcaactacgcgaacggcgatatggtgggccacacgggcgtccgcgacgcgtccatcatg
gccgtcgaagcggtcgacctctcgatcgggcgcctgctcccggtggtcaaggcgctgaac
ggcgtgctcctcgtcacggccgaccacggcaacgccgacgagatgtacgagctcgtgaag
aagaccggcgccttcgagacgctcgcggacggctcgccgaagccgaagacgagccacacg
ctcaacccggtgccgttccacgtctatgcgcccggctacacgttcgcgatcgacaccacc
gtgcagaagcccggcctcgcgaacatgggggccaccgtgctccacctcctgggcctcagc
gctccggaggactacctcccgtcgctgatcgctggctga

DBGET integrated database retrieval system