KEGG   Sorangium cellulosum So ce 56: sce4900Help
Entry
sce4900           CDS       T00634                                 

Gene name
adh5
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
scl  Sorangium cellulosum So ce 56
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:scl00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    sce4900 (adh5)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    sce4900 (adh5)
  Lipid metabolism
   00071 Fatty acid degradation
    sce4900 (adh5)
  Amino acid metabolism
   00350 Tyrosine metabolism
    sce4900 (adh5)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    sce4900 (adh5)
   00626 Naphthalene degradation
    sce4900 (adh5)
Enzymes [BR:scl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     sce4900 (adh5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6881150..6882145)
Genome map
AA seq 331 aa AA seqDB search
MRALVLRAPKSPLVLEDRPAPRPGPGEVLLRVRACAVCRTDLHVVDGELPDPRLPLVPGH
QIVGEVLEEVPPPGDGPRFARGARVGVPWLGWTCGVCAYCRAGRENLCDRARFTGYQIDG
GYAELAVADARFCFPIPDGFPDLSAAPLLCAGLIGYRTLRLAGDAERIGIYGFGAAAHLV
AQVARFEGRRVFGFVRPGDDAARAFALSMGAEWAGASFEAPPEELDAALIFAPAGELVPA
ALRAVRKGGAVVCGGIHMSDIPSFPYSILWGERVLRSVANLTRRDGEEFLALAPRVPVRT
EVNVYPLAAANEALDDLRNGRMSGAAVLVPP
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccctcgtcctgagagccccgaagagcccgctcgtgctggaggatcggcccgct
ccgcggcctgggcccggcgaggtgctgctccgcgtgcgcgcctgcgccgtgtgccgcacc
gatctgcacgtggtcgacggcgagctgccggaccccaggctgccgctcgtgcccgggcac
cagatcgtgggcgaggtcctcgaggaggtgcccccgcccggcgacgggccgcggttcgcg
aggggcgcacgcgtcggcgtgccctggctcggctggacctgcggcgtgtgcgcgtattgc
cgtgcaggacgggaaaacctctgcgaccgggcgcgctttaccgggtaccagatcgacggc
gggtatgcggagctcgcggtcgcggacgcgcgcttctgcttcccgatccccgacggcttc
ccggacctctcggccgcgccgctgctctgcgccgggctcatcgggtacaggacgctgcgt
ctggcgggggacgcggagcggattggcatctacgggttcggcgccgccgcccacctcgtg
gcgcaggtcgcccgcttcgagggccggcgcgtcttcgggttcgtccggccgggggacgac
gctgcgcgcgcgttcgcgctgtcgatgggggccgagtgggcgggcgcttccttcgaagcg
ccccccgaggagctcgacgcggcgctgatcttcgccccggccggcgagctggtgccggcc
gcgctgcgcgccgtacgcaagggcggcgccgtggtctgcgggggaatccacatgagcgac
atcccctcgttcccctattcgatcctgtggggcgagcgggtgctgcggtcggtggcgaac
ctgacgcgccgcgacggcgaggagttcctcgcgctcgcgccgcgggtgccggtgcggacg
gaggtgaacgtctatccgctggctgcggcgaacgaggcgctcgacgatctgcggaacggc
cgcatgtccggggcagcggtgctcgtgccgccgtga

DBGET integrated database retrieval system