KEGG   Sorangium cellulosum So ce 56: sce4910Help
Entry
sce4910           CDS       T00634                                 

Gene name
celB
Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
scl  Sorangium cellulosum So ce 56
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    sce4910 (celB)
Enzymes [BR:scl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     sce4910 (celB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6896157..6897056
Genome map
AA seq 299 aa AA seqDB search
MERHGRLRVMGNRVVDEHGEELQLKGMSMFWSVWEGEKFYNASAVDTLVNDWDATVVRAA
MTANISGLGYVNNPDAEKRKVKAIVDAAIARGIYVLIDWHDHDAVQPRNKEAAKRFFREM
ATEYGDEPAVIFEVFNEPDTETWAQVKAYAEEVIREIRGAGSDNLVIVGSPTWSQDVDVA
ADNPITSYDNIAYTLHFYAATHKDGLRAKATTAMTKGLALFVTEWGTCASTGDGALDLAE
AQRWLDFMASNSISWLNWSIVDKAESCAALRPGASAGGPWSDGQLTESGRWVKQKIQAP
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
gtggagcggcacggccgcctgagggtgatgggcaaccgcgtcgtcgacgagcacggcgaa
gagctccagctcaagggcatgagcatgttctggagcgtctgggagggagagaagttctac
aacgcttccgccgtcgacacgctcgtgaacgactgggatgcgaccgtcgtccgcgccgcg
atgaccgccaacatatcggggctcggctacgtcaacaacccggacgcggagaagcggaag
gtcaaggcgatcgtcgacgccgccatcgccagaggcatctacgtgctcatcgactggcac
gatcacgacgcggtccagccccggaacaaggaggccgcgaagcgcttcttccgggagatg
gcgacggagtacggcgacgagcccgccgtgatcttcgaggtgttcaacgagcccgacacc
gagacctgggcgcaggtgaaggcgtatgccgaggaggtgatccgtgagatccgcggcgcc
ggctccgacaacctcgtcatcgtcgggtcgccgacctggtcgcaggacgtggacgtcgcc
gccgacaacccgatcacgagctacgacaacatcgcctacacgctccacttctatgcggcg
acgcacaaggatgggctgcgcgccaaggcgacgaccgcgatgaccaagggcctcgcgctg
ttcgtcaccgagtggggcacctgcgctagcaccggggacggcgcgctggatctcgccgag
gcgcagcggtggctcgacttcatggccagcaacagcatcagctggctcaactggtccatc
gtcgacaaggccgagtcctgcgcggcgctcaggcccggagcgagcgccggcggcccgtgg
tcggatggccagctgaccgagtcggggcggtgggtgaagcagaagatccaggcgccttga

DBGET integrated database retrieval system