KEGG   Sorangium cellulosum So ce56: sce5330Help
Entry
sce5330           CDS       T00634                                 

Gene name
aao
Definition
(GenBank) D-amino-acid oxidase
  KO
K00273  D-amino-acid oxidase [EC:1.4.3.3]
Organism
scl  Sorangium cellulosum So ce56
Pathway
scl00260  Glycine, serine and threonine metabolism
scl00311  Penicillin and cephalosporin biosynthesis
scl00330  Arginine and proline metabolism
scl00472  D-Arginine and D-ornithine metabolism
scl01100  Metabolic pathways
scl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:scl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    sce5330 (aao)
   00330 Arginine and proline metabolism
    sce5330 (aao)
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    sce5330 (aao)
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    sce5330 (aao)
Enzymes [BR:scl01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     sce5330 (aao)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO NAD_binding_8 Pyr_redox FAD_binding_2 Pyr_redox_2 3HCDH_N Glu_dehyd_C UDPG_MGDP_dh_N FAD_binding_3 NAD_binding_7 ApbA Glyco_transf_4 2-Hacid_dh_C NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-ProteinID: CAN95493
UniProt: A9FX96
Position
7496024..7497034
Genome map
AA seq 336 aa AA seqDB search
MSTLRRGVLERAIVASSRGQAQGQQITVVGAGVIGLTTAVVLQRDGHRVQVIAAARGERT
TSAVAAALWHPFLANPPERVNAWSSRSLDELTRIANEHPEAGVDLLTAREAADDTRLPWW
APSVPDLALEPGPHPLGAPYSLRFTAPRIEPSLHLPWLEAQLDCPVRAEHVRSLAEVEGD
CIVNCTGLGARALTGDGELIGVYGQVAIVEPGEIPPDVALGDERDESALVYVIPRRREIV
IGGCFIPSPDDRPLTPDPELADAMLQRVRAAGLKPGRLLGSRAGLRPYRSTVRVEREGRV
IHNYGHGGSGYTLAWGCAHEVSAMLRDGNGSTHGHV
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgctgaggcgcggcgtgctagagcgcgcgatcgtggcgtcatcacggggccag
gctcaagggcagcagatcaccgtcgtgggcgcaggggtgatcgggttgaccacggcggtc
gtcctccagcgcgacggccaccgggtgcaggtgatcgcagcggcgcgcggcgagcgcacg
acctccgcggtcgcggcggcgctgtggcatcctttcctggcgaacccgcccgagcgcgtc
aacgcgtggtcctcgaggagcctcgatgaactcacgcgcatcgcgaacgaacacccggag
gcgggcgtggatctcctgaccgcgcgcgaggcggcggacgacacgcgcctgccgtggtgg
gctccgagcgtcccggacctcgcgctcgagcctggaccccacccgctgggcgcgccgtac
agcctgcgattcacggcgccgcgcatcgagccatcgttgcacctgccctggctggaggcg
cagctcgactgtccagtgcgcgccgagcacgtgcgatcgctcgccgaggtcgagggtgac
tgcatcgtgaattgcaccgggctcggcgcgcgcgcgctcaccggcgatggcgagctcatc
ggcgtgtacggccaggtcgcgatcgtcgaaccaggcgagatccccccagatgtcgcactg
ggtgatgaaagggacgaatcggcgctcgtttatgtcatcccaaggcgtcgcgagatcgtg
attggcggttgtttcatcccgtcgcccgatgatcgcccgttgacgcctgatcccgagctc
gctgacgcaatgctccagcgggtgcgcgcggccgggctcaagccgggccgcttgctcggc
tcacgcgccgggctgcgcccttaccggagcaccgtgcgggtggagcgagaaggccgtgtg
atccacaactacggccacggcggttcgggatacacgctggcatggggttgtgcccacgag
gtgagcgcaatgctgcgggacggcaacgggtcgacacacggccatgtctag

DBGET integrated database retrieval system