KEGG   Sorangium cellulosum So ce 56: sce5330Help
Entry
sce5330           CDS       T00634                                 

Gene name
aao
Definition
D-amino-acid oxidase (EC:1.4.3.3)
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
scl  Sorangium cellulosum So ce 56
Pathway
Glycine, serine and threonine metabolism
Penicillin and cephalosporin biosynthesis
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    sce5330 (aao)
   00330 Arginine and proline metabolism
    sce5330 (aao)
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    sce5330 (aao)
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    sce5330 (aao)
Enzymes [BR:scl01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     sce5330 (aao)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7496024..7497034
Genome map
AA seq 336 aa AA seqDB search
MSTLRRGVLERAIVASSRGQAQGQQITVVGAGVIGLTTAVVLQRDGHRVQVIAAARGERT
TSAVAAALWHPFLANPPERVNAWSSRSLDELTRIANEHPEAGVDLLTAREAADDTRLPWW
APSVPDLALEPGPHPLGAPYSLRFTAPRIEPSLHLPWLEAQLDCPVRAEHVRSLAEVEGD
CIVNCTGLGARALTGDGELIGVYGQVAIVEPGEIPPDVALGDERDESALVYVIPRRREIV
IGGCFIPSPDDRPLTPDPELADAMLQRVRAAGLKPGRLLGSRAGLRPYRSTVRVEREGRV
IHNYGHGGSGYTLAWGCAHEVSAMLRDGNGSTHGHV
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgctgaggcgcggcgtgctagagcgcgcgatcgtggcgtcatcacggggccag
gctcaagggcagcagatcaccgtcgtgggcgcaggggtgatcgggttgaccacggcggtc
gtcctccagcgcgacggccaccgggtgcaggtgatcgcagcggcgcgcggcgagcgcacg
acctccgcggtcgcggcggcgctgtggcatcctttcctggcgaacccgcccgagcgcgtc
aacgcgtggtcctcgaggagcctcgatgaactcacgcgcatcgcgaacgaacacccggag
gcgggcgtggatctcctgaccgcgcgcgaggcggcggacgacacgcgcctgccgtggtgg
gctccgagcgtcccggacctcgcgctcgagcctggaccccacccgctgggcgcgccgtac
agcctgcgattcacggcgccgcgcatcgagccatcgttgcacctgccctggctggaggcg
cagctcgactgtccagtgcgcgccgagcacgtgcgatcgctcgccgaggtcgagggtgac
tgcatcgtgaattgcaccgggctcggcgcgcgcgcgctcaccggcgatggcgagctcatc
ggcgtgtacggccaggtcgcgatcgtcgaaccaggcgagatccccccagatgtcgcactg
ggtgatgaaagggacgaatcggcgctcgtttatgtcatcccaaggcgtcgcgagatcgtg
attggcggttgtttcatcccgtcgcccgatgatcgcccgttgacgcctgatcccgagctc
gctgacgcaatgctccagcgggtgcgcgcggccgggctcaagccgggccgcttgctcggc
tcacgcgccgggctgcgcccttaccggagcaccgtgcgggtggagcgagaaggccgtgtg
atccacaactacggccacggcggttcgggatacacgctggcatggggttgtgcccacgag
gtgagcgcaatgctgcgggacggcaacgggtcgacacacggccatgtctag

DBGET integrated database retrieval system