KEGG   Sorangium cellulosum So ce 56: sce5602Help
Entry
sce5602           CDS       T00634                                 

Gene name
hemY2
Definition
hypothetical protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
scl  Sorangium cellulosum So ce 56
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:scl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    sce5602 (hemY2)
Enzymes [BR:scl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     sce5602 (hemY2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7891527..7892594)
Genome map
AA seq 355 aa AA seqDB search
MRRVAVIGGGLAGCIVAFRRAMAGDQVTLVEAAPRVGGQLWTERASGFVVELGAEGFIAR
SEAVPGLASALGIAGDLVGQETHRSFGFDGVALRELAPGEAAEFLGFQVPRDELGKGIRT
FRLGMAQLTETLALAIAGRVEVRSSAAVASLAPVAGGFRLALAGGAEIDADAVVLATHAA
GAAALLGEAGWALRGAETLSSVTVSLAYPRAAIEHPLDGTGFVVAAGHQAHGFRACTFTT
SKFAERAPAGHVTLRLFFRPDPADLEQMGDDAWTARAEASLARVLRVHGPSERAWVSRWS
SALPVSTPAHAARVREVEQALAGSGVLLAGSAFHGSGIDAAVRSAEAAAERVGAL
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgcgacgcgttgccgtcattggaggcggtctggccgggtgcatcgttgcgttccggcga
gcgatggcgggcgaccaggtgacgctcgtcgaggcggctccgcgggtcggcggacagctc
tggacggagcgggcctctggcttcgtcgtcgagctcggcgccgaggggttcatcgcgcgg
agcgaggcagtccctgggctggcgagcgcgctcggcatcgccggcgatctcgtcggtcag
gagacgcaccggtcgttcggcttcgacggcgtcgcgctgcgggagctcgcgccgggcgag
gcggcggagttcctcggcttccaggtgccgcgcgacgagctcggcaaggggatccggacc
ttccgcctcgggatggcgcagctgaccgagacgctcgcgctcgcgatcgccgggcgcgtc
gaggtgcgctcctccgcagcggtcgcctcgctcgcgccggtggccggcggcttccgcctc
gcgctcgccggaggcgccgagatcgacgccgacgcggtcgtcctcgccacccacgccgcc
ggcgcggccgcgctgctcggcgaggcggggtgggcgctccgcggcgccgagacgctctcc
agcgtgacggtctcgctggcgtacccgcgcgccgcgatcgagcacccgctcgacggcacc
ggcttcgtcgtcgccgcggggcaccaggcgcacggcttccgcgcgtgcacgttcacgacc
tcgaagttcgccgagcgcgcccccgccggccacgtcacgcttcgcctcttcttccgcccg
gatccggcggacctcgagcagatgggcgacgacgcctggacggcgcgcgccgaggcctcg
ctcgcccgcgtgctgcgcgtgcacgggccctcggagcgcgcgtgggtctcgcgctggtcg
agcgcgctcccggtctccacccccgcccacgcggcgcgggtccgggaggtcgagcaggcg
ctcgccggcagcggcgtcctcctcgccggatcggcgttccacggatccgggatcgacgcc
gccgtgcgctccgccgaggcggccgcggagcgcgtcggggcgctgtag

DBGET integrated database retrieval system