KEGG   Sorangium cellulosum So ce 56: sce5822Help
Entry
sce5822           CDS       T00634                                 

Definition
methylamine utilization protein (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
scl  Sorangium cellulosum So ce 56
Brite
Enzymes [BR:scl01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     sce5822
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8176415..8177638)
Genome map
AA seq 407 aa AA seqDB search
MAMFASMTALRRSAISSALAALAALCCACGDDDGPGGSTGEGGGGDGGGGAGAYAWGLPA
GFPVPKVPEDNPMSSVKVELGRRLFYDVRLSGNGTYSCGSCHRQELAFTDHLANAEGSTG
QLHSRSSMSLANVAYLTTLTWANPLIEALEEQALLPMFGETPVELGLAGMEDELLERLQG
EPLYQDLFPEAFPGDDEPIRLANITKAIAAFERSLLSYRAPYDRYRYGGDPSGMSDAALR
GMDLFFSEKLECFHCHGGFNLSDSVEHDGTTFTEVMFHNTGLYNIDGNGAYPEGNGGVYE
VSHKEADMGRFRAPTLRNIAVTAPYMHDGSIETLEGVLDHYAAGGRTIEAGLPNAGVGSE
NKFKSELISGFDLTGEERADVIAFLQTLTDDEFLKDPRFADPWAEAP
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgttcgcttcgatgacagctctccgccgctcggcgatctcctccgccctcgcc
gcgctcgcggccctctgctgtgcctgcggcgacgacgatggcccgggcggatcgacgggg
gagggcggcggcggcgatgggggaggcggcgcgggcgcctatgcgtgggggctgccggcg
ggttttccggtgcccaaggtccccgaggacaacccgatgtcgtcggtgaaggtcgagctc
ggcaggcggctgttctacgacgtgcgcctgtccggcaacggcacgtactcgtgcggctcg
tgccatcgccaggagctcgcgttcaccgaccacctcgcgaacgccgagggctcgaccggc
cagctgcactcgcgcagctcgatgagcctggccaacgtcgcttacctcacgacgctgacc
tgggcgaatccgctcatcgaagcgctcgaggagcaagcgctcctgcccatgttcggcgag
acgccggtcgagctcgggctcgccggcatggaggacgagctcctcgagcggctgcagggc
gagccgctgtaccaggacctctttcccgaggccttccccggcgacgacgagcccatccgc
ctcgcgaacatcacgaaggcgatcgcggcgttcgagcgatcgctgctctcctaccgcgcg
ccctacgaccgttaccgttacggcggcgacccctccgggatgtccgacgcggcgctgcgc
gggatggatctcttcttctccgagaagctggagtgctttcattgccacggcggcttcaac
ctgtcggactcggtggagcacgacggcaccaccttcacggaggtgatgttccacaacacg
gggctctacaacatcgacggcaacggcgcttacccggagggcaacgggggagtctacgag
gtctcccacaaagaggcggacatgggccggttccgcgcgcccacgctgcggaacatcgcc
gtcacggcgccgtacatgcatgacggcagcatcgagacgctcgagggggtgctcgaccat
tacgccgccggagggcgaacgatcgaggctggcctccccaacgccggtgtgggcagcgag
aacaagttcaagagcgagctcatcagcgggttcgatctcacaggagaggagagagcggac
gtgatcgccttcttgcaaaccctgacggacgacgagtttctgaaggacccgcgcttcgcg
gatccctgggcggaggcgccgtga

DBGET integrated database retrieval system