KEGG   Sorangium cellulosum So ce 56: sce5865Help
Entry
sce5865           CDS       T00634                                 

Gene name
pfk
Definition
hypothetical protein
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
scl  Sorangium cellulosum So ce 56
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:scl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    sce5865 (pfk)
   01230 Biosynthesis of amino acids
    sce5865 (pfk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    sce5865 (pfk)
   00030 Pentose phosphate pathway
    sce5865 (pfk)
   00051 Fructose and mannose metabolism
    sce5865 (pfk)
   00052 Galactose metabolism
    sce5865 (pfk)
  Energy metabolism
   00680 Methane metabolism
    sce5865 (pfk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    sce5865 (pfk)
Enzymes [BR:scl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     sce5865 (pfk)
Protein phosphatases and associated proteins [BR:scl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     sce5865 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8239545..8240714)
Genome map
AA seq 389 aa AA seqDB search
MSIASPGAARDAASLMAARKIAISTGGGDAPGLNAVIRAATLGALERGWEVWGIRQGYRG
LLDDAPDGLIRLDRERVRGIAHLGGTILGTANRGDPFHYPTPGEHGLVPRDRSEDLVRRF
RAEGFDALISVGGDGSMRIAHQLLQRGLPLVIGVPKTIDNDVCCTDLTFGFDTAVSIATE
ALDRLHTTTEAHERIMVVEVMGRHAGWIALNAGIAGGADAILIPEIPFRFEAIAEKIRLR
ESRGRRFSIVVAAEGAYAQGGELIIKDAGDAFRRTAVLGGVAERVAKELAARTGKEARSM
VLGHLQRGGGPTTADRLLALRFGAAAARCLVEDCGSGMVALRSNRIELVPLEEVAGKTKT
VPLDSDTVVTAREMGLCFGDEAPGHFVAP
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgtctattgcgtcgccgggggcggctcgcgatgctgcgagcctcatggcggcacgaaag
atcgctatcagtaccggcggaggcgacgcgccggggctcaacgctgtgatccgcgcggcc
acgctcggcgcgctcgagcgtggctgggaggtgtgggggatccggcaggggtaccgcggg
ttgctcgacgacgctccggacgggctcatccgcctggatcgcgagcgggtccggggcatc
gcgcacctcgggggcaccatcctgggcaccgcgaaccgcggcgatccgttccactacccg
acgcctggcgagcacgggctcgtgccgcgggatcgatccgaggatctcgtgcggcggttt
cgcgcggaggggttcgacgcgctcatctcggtgggcggagacggatccatgcggatcgcg
caccagctgctccagcgcgggctgcccctcgtcatcggcgtaccgaagacgatcgacaac
gacgtctgctgcacggacctcacgttcggcttcgacacggcggtctccatcgcgaccgag
gcgctcgaccggctccacaccacgaccgaggcgcacgagcggatcatggtcgtggaggtg
atggggcggcacgcgggctggatcgcgctcaacgccgggatcgccggcggagccgacgcc
atcctgatcccggagatcccgttccggttcgaggcgatcgccgagaagatccgcctgcgg
gagtcgcgcgggcgccgcttctccatcgtcgtggcggccgagggggcgtacgcgcaaggg
ggtgagctgatcatcaaggacgcgggcgacgcgttccgccgcaccgccgtgctcgggggc
gtggccgagcgcgtggccaaggagctcgcggcccgcaccggcaaggaagcgcgctcgatg
gtgctcggccacctccagcggggcggcggccccacgacggcggatcgcttgctcgccctc
cgcttcggcgcggccgcggcgcgctgcctcgtcgaggactgcggcagcgggatggtggcg
ctgcgctcgaaccggatcgagctcgtccccctcgaggaggtcgccggcaagacgaagacg
gtgccgctcgactcggacacggtcgtcacggcccgtgagatggggctgtgcttcggagac
gaggcgcccggccacttcgtcgcgccctga

DBGET integrated database retrieval system