KEGG   Sorangium cellulosum So ce 56: sce5865Help
Entry
sce5865           CDS       T00634                                 

Gene name
pfk
Definition
(GenBank) High confidence in function and specificity
  KO
K21071  
ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
scl  Sorangium cellulosum So ce 56
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:scl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    sce5865 (pfk)
   00030 Pentose phosphate pathway
    sce5865 (pfk)
   00051 Fructose and mannose metabolism
    sce5865 (pfk)
   00052 Galactose metabolism
    sce5865 (pfk)
  Energy metabolism
   00680 Methane metabolism
    sce5865 (pfk)
Enzymes [BR:scl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     sce5865 (pfk)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     sce5865 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(8239545..8240714)
Genome map
AA seq 389 aa AA seqDB search
MSIASPGAARDAASLMAARKIAISTGGGDAPGLNAVIRAATLGALERGWEVWGIRQGYRG
LLDDAPDGLIRLDRERVRGIAHLGGTILGTANRGDPFHYPTPGEHGLVPRDRSEDLVRRF
RAEGFDALISVGGDGSMRIAHQLLQRGLPLVIGVPKTIDNDVCCTDLTFGFDTAVSIATE
ALDRLHTTTEAHERIMVVEVMGRHAGWIALNAGIAGGADAILIPEIPFRFEAIAEKIRLR
ESRGRRFSIVVAAEGAYAQGGELIIKDAGDAFRRTAVLGGVAERVAKELAARTGKEARSM
VLGHLQRGGGPTTADRLLALRFGAAAARCLVEDCGSGMVALRSNRIELVPLEEVAGKTKT
VPLDSDTVVTAREMGLCFGDEAPGHFVAP
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgtctattgcgtcgccgggggcggctcgcgatgctgcgagcctcatggcggcacgaaag
atcgctatcagtaccggcggaggcgacgcgccggggctcaacgctgtgatccgcgcggcc
acgctcggcgcgctcgagcgtggctgggaggtgtgggggatccggcaggggtaccgcggg
ttgctcgacgacgctccggacgggctcatccgcctggatcgcgagcgggtccggggcatc
gcgcacctcgggggcaccatcctgggcaccgcgaaccgcggcgatccgttccactacccg
acgcctggcgagcacgggctcgtgccgcgggatcgatccgaggatctcgtgcggcggttt
cgcgcggaggggttcgacgcgctcatctcggtgggcggagacggatccatgcggatcgcg
caccagctgctccagcgcgggctgcccctcgtcatcggcgtaccgaagacgatcgacaac
gacgtctgctgcacggacctcacgttcggcttcgacacggcggtctccatcgcgaccgag
gcgctcgaccggctccacaccacgaccgaggcgcacgagcggatcatggtcgtggaggtg
atggggcggcacgcgggctggatcgcgctcaacgccgggatcgccggcggagccgacgcc
atcctgatcccggagatcccgttccggttcgaggcgatcgccgagaagatccgcctgcgg
gagtcgcgcgggcgccgcttctccatcgtcgtggcggccgagggggcgtacgcgcaaggg
ggtgagctgatcatcaaggacgcgggcgacgcgttccgccgcaccgccgtgctcgggggc
gtggccgagcgcgtggccaaggagctcgcggcccgcaccggcaaggaagcgcgctcgatg
gtgctcggccacctccagcggggcggcggccccacgacggcggatcgcttgctcgccctc
cgcttcggcgcggccgcggcgcgctgcctcgtcgaggactgcggcagcgggatggtggcg
ctgcgctcgaaccggatcgagctcgtccccctcgaggaggtcgccggcaagacgaagacg
gtgccgctcgactcggacacggtcgtcacggcccgtgagatggggctgtgcttcggagac
gaggcgcccggccacttcgtcgcgccctga

DBGET integrated database retrieval system