KEGG   Sorangium cellulosum So ce56: sce6078Help
Entry
sce6078           CDS       T00634                                 

Definition
(GenBank) Fatty acid desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
scl  Sorangium cellulosum So ce56
Pathway
scl01040  Biosynthesis of unsaturated fatty acids
scl01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:scl00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    sce6078
Enzymes [BR:scl01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     sce6078
Lipid biosynthesis proteins [BR:scl01004]
 Desaturase
  First
   sce6078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-ProteinID: CAN96242
UniProt: A9GCV0
Position
complement(8513103..8513876)
Genome map
AA seq 257 aa AA seqDB search
MEIAIVLIAHSTLSVFFQTFFLHRYASHRMFTMSKPWERIFHFLTYLTQGSSYLVPWVYA
ILHRMHHAYSDTPKDPHSPRYYSNVVRMMLDTAHRYDAIYEGKADVEPRFLGGYPEWPTL
DRIGNAWIGRLAWGTGYVLFYVAFASHWWQFLFLPLHWTMGPLHGAIVNWCGHRYGYRNF
DSDDDSRNTLALDLVTLGELFQNNHHKYAMSPNFAVRWFEIDPAYQVIRVLAWVGIIRMS
DKVQVARLEPEVARAEG
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggagatcgcgatcgtcctcatcgcccactctacgctctcggtctttttccagaccttc
ttcctgcaccggtacgcctcgcatcggatgttcacgatgtcgaagccatgggagcggatt
ttccacttcctcacgtacctcacgcagggctcgtcgtacctcgtgccctgggtttacgcg
atcttgcaccgcatgcaccacgcgtacagcgacacgccgaaggatccgcactcgccgcgg
tactactcgaatgtcgtccggatgatgctggacaccgcgcaccgctacgacgcgatctac
gagggcaaggccgacgtggagccgcgcttcctcggcggctaccccgagtggcccacgctc
gaccgcatcggcaacgcgtggatcggccggctcgcgtggggcaccggctacgtgctcttc
tacgtggccttcgcctcgcactggtggcagttcctgttcctcccgctccactggaccatg
ggcccgctgcacggggcgatcgtgaactggtgcggccaccgctatggctaccgcaacttc
gacagcgacgacgactcccgcaacacgctggccctcgatctcgtgacgctcggcgagctc
ttccagaacaaccaccacaagtacgcgatgagcccgaacttcgcggtgcggtggttcgag
atcgacccggcgtatcaggtcatccgcgtgcttgcctgggtggggatcatccggatgtcc
gacaaggtccaagtcgcccggctcgagcccgaggtcgcgcgggctgaaggctga

DBGET integrated database retrieval system