KEGG   Sorangium cellulosum So ce 56: sce6078Help
Entry
sce6078           CDS       T00634                                 

Definition
Fatty acid desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
scl  Sorangium cellulosum So ce 56
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:scl00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    sce6078
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    sce6078
Enzymes [BR:scl01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     sce6078
Lipid biosynthesis proteins [BR:scl01004]
 Desaturase
  First
   sce6078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8513103..8513876)
Genome map
AA seq 257 aa AA seqDB search
MEIAIVLIAHSTLSVFFQTFFLHRYASHRMFTMSKPWERIFHFLTYLTQGSSYLVPWVYA
ILHRMHHAYSDTPKDPHSPRYYSNVVRMMLDTAHRYDAIYEGKADVEPRFLGGYPEWPTL
DRIGNAWIGRLAWGTGYVLFYVAFASHWWQFLFLPLHWTMGPLHGAIVNWCGHRYGYRNF
DSDDDSRNTLALDLVTLGELFQNNHHKYAMSPNFAVRWFEIDPAYQVIRVLAWVGIIRMS
DKVQVARLEPEVARAEG
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggagatcgcgatcgtcctcatcgcccactctacgctctcggtctttttccagaccttc
ttcctgcaccggtacgcctcgcatcggatgttcacgatgtcgaagccatgggagcggatt
ttccacttcctcacgtacctcacgcagggctcgtcgtacctcgtgccctgggtttacgcg
atcttgcaccgcatgcaccacgcgtacagcgacacgccgaaggatccgcactcgccgcgg
tactactcgaatgtcgtccggatgatgctggacaccgcgcaccgctacgacgcgatctac
gagggcaaggccgacgtggagccgcgcttcctcggcggctaccccgagtggcccacgctc
gaccgcatcggcaacgcgtggatcggccggctcgcgtggggcaccggctacgtgctcttc
tacgtggccttcgcctcgcactggtggcagttcctgttcctcccgctccactggaccatg
ggcccgctgcacggggcgatcgtgaactggtgcggccaccgctatggctaccgcaacttc
gacagcgacgacgactcccgcaacacgctggccctcgatctcgtgacgctcggcgagctc
ttccagaacaaccaccacaagtacgcgatgagcccgaacttcgcggtgcggtggttcgag
atcgacccggcgtatcaggtcatccgcgtgcttgcctgggtggggatcatccggatgtcc
gacaaggtccaagtcgcccggctcgagcccgaggtcgcgcgggctgaaggctga

DBGET integrated database retrieval system