KEGG   Sorangium cellulosum So ce 56: sce6080Help
Entry
sce6080           CDS       T00634                                 

Gene name
yedO
Definition
D-cysteine desulfhydrase (EC:3.5.99.7)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
scl  Sorangium cellulosum So ce 56
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:scl00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8514838..8515827)
Genome map
AA seq 329 aa AA seqDB search
MRKRLALSHLPTPIQRPQRLAEALGVDLYVKRDDMTAGAEAGNKIRKLEYLLAAAREEGA
GCVITCGGLQSNHARATALVSASLGLRSVLFLRTSDPSAAAPLEGNVLLDRLAGAEIRLI
SPEAYRDRGALMAEAAAEIRAAGGRPYVIPEGGSNGLGALGYVRAMEEIRKQLDLGLAGG
KPFDVIVHACGSGGTAAGTALGAARYEVAGEVRSMAVCEDRATFARIVVGIMDDARALEP
RLGSPAHLVIDDSAKGPAYGVSTPEQRARILQVARLSGLVLDPVYTGKAFSGLWDLAERG
ELSGKRVLFLHTGGLPGLLAQGATFADAL
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaacgactcgcgctgagccaccttccgacaccgatccagcgcccgcagcggctc
gccgaggcgctcggcgtcgacctctacgtgaagcgcgacgacatgacggcgggcgcggag
gccggcaacaagatccgcaagctcgagtacctgctcgccgccgcgcgcgaggagggcgcg
ggctgcgtgatcacctgcggcggcctccagtcgaaccacgcgcgcgcgaccgcgctggtg
agcgcctcgctcggcctgcgctcggtgctgttcctgcgcacgagcgatccgtcggcggcc
gcgccgctcgagggcaacgtgctgctcgaccggctcgccggcgcggagatccggctgatc
tcgcccgaggcgtacagggaccgcggcgccctgatggccgaggcggccgccgagatccgc
gcggcgggcggccggccgtacgtgatccccgagggcggctcgaacggcctcggcgcgctc
ggctacgtgcgcgcgatggaggagatccggaagcagctcgatctcggcctcgcggggggc
aagccgttcgacgtcatcgtgcacgcgtgcggctccggcgggacggcggcgggcaccgcg
ctcggcgcggcccgctacgaggtcgccggcgaggtgcgctcgatggcggtctgcgaggac
agggcgacgttcgcgcggatcgtggtcgggatcatggacgacgcgcgcgcgctcgagccg
cgcctcggctcgcccgcccacctcgtgatcgacgactcggcgaagggccctgcctacggg
gtgtccacgccggagcagcgagcgcggatcctccaggtggcgcggctgtcgggcctcgtc
ctcgaccccgtgtacacgggcaaggcgttctccgggctctgggacctggccgagcgaggc
gagctctcgggcaagcgggtgctgttcctgcacaccggcggtctccccggcctcctcgcc
cagggcgcgaccttcgccgacgccctctag

DBGET integrated database retrieval system