KEGG   Sorangium cellulosum So ce 56: sce6253Help
Entry
sce6253           CDS       T00634                                 

Definition
hypothetical protein
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
scl  Sorangium cellulosum So ce 56
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8738392..8739255)
Genome map
AA seq 287 aa AA seqDB search
MGTETRAAVAPLAALAARYDDRRPDRWEPVPERLDAAIACDVELAEAGRVARAPLVAELA
RRFEFLAHYLDAILLVPRERFVLPEDLAASADDTPLPLDRAGQATVSAPHAYLLTYSLLD
LGPGDRLLELGTGTGYGVALARRIVGPTGHVASIEIDPVLHARAVRLLGARPDRQEGDEA
RAASAAGPSDEGAGVTLLCGDGRSLAERVLAGERTSPSERPWKVAVTYALTEPPTALEAQ
LSDGGVLVAPVGAWEGHQELVRVERRQGALLREVHGAVRYVAERGRG
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
gtgggcaccgaaacacgcgccgccgtcgcgccgctcgccgcgctcgcggcgaggtacgac
gatcgccggcccgatcgctgggagccggtccccgagcggctcgacgcggccatcgcgtgc
gacgtcgagctcgccgaggccggccgcgtcgcgcgggcgccgctcgtggccgagctcgcg
cgccgcttcgagttccttgcccactacctggacgcgatcctgctcgtgccgcgcgagcgc
ttcgtcctgccggaggatctcgccgcgtcggcggacgacacgccgttgccgctcgaccgc
gcggggcaggcgaccgtgagcgcgccgcacgcgtacctgctcacgtacagcctgctcgat
ctcggtccgggcgatcgattgctcgagctcggcacgggcaccggttatggggtggcgctc
gcgcggcgcatcgtcggcccgaccgggcacgtcgcctcgatcgagatcgaccccgtgctg
cacgcgcgcgcggtgcggctgctcggcgcgcggccggatcgccaggagggcgacgaggcg
cgcgcggccagcgccgccggcccgtccgacgagggcgcgggcgtcacgttgctgtgcggc
gacgggcgctcgctcgccgagcgcgtgctcgcgggcgagcggacatcgccgtcggagcgg
ccctggaaggtcgcggtgacgtacgcgctgaccgagcctcccacggcgctcgaggcgcag
ctgagcgacgggggcgtccttgtcgcgccggtcggcgcgtgggagggccaccaggagctc
gtgcgtgtcgagcgccggcagggcgcgctcctccgcgaggtgcacggcgcggtccgctac
gtggcggagcgcgggcgcggctag

DBGET integrated database retrieval system