KEGG   Sorangium cellulosum So ce 56: sce6586Help
Entry
sce6586           CDS       T00634                                 

Gene name
aceF2
Definition
dihydrolipoyllysine-residue acetyltransferase (EC:2.3.1.12)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
scl  Sorangium cellulosum So ce 56
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:scl01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:scl00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:scl00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9160574..9161899
Genome map
AA seq 441 aa AA seqDB search
MVEVRMPQLGESVVEGTVSRWLVREGDFVKREQPLLEVATDKADTEIPAPVAGRVSQIAV
AEGTVVAKEGLLCRIDETAQGEAQATAQRASAPPAPSEARPAAPAPGSNGHDESARPLTS
PSTKKLARESGVDLRDVHGTGDHGRITRDDVMRAAHGASAEPAPQPSAAAQPASAAAELS
QLIQASGGFVPPVPGVGYGAYKVPPYSPKPGDKVVPFSRRRRITADHMVYSKVTSPHVVT
VAEVDLHETSKLRDLHKDEFKRAGVSLTFLSFICAAAVRALREHPEFNARVLENSYVVLR
DVNLGVAVDTPGGLIVPSIKHADELSLRGIARSIDELAGRAKSGKITADDLANTTFTVSN
PGLKGNLFGGAIISQPNVGILRMGEIKKRVVVVTKDKEDSIAIHPVMFLALSYDHRIIDG
VLANSFLWRVTDILTRGEFEV
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaagtccgcatgccacagctcggtgagagcgtggtcgagggaaccgtctcgagg
tggctcgtgcgcgagggcgatttcgtcaagcgcgagcagccgctgctcgaggtcgcgacc
gacaaggccgatacggagatcccggcgcccgtcgcgggtcgtgtctcgcagatcgcggtg
gccgagggcaccgtcgtcgccaaggaaggtctgctctgtcggatcgacgagacggcgcag
ggcgaggcccaggcgacggcccagcgcgcgagcgcgccgccggcgccgtccgaagcgcgg
cccgccgcgccggcgcccggcagcaacggacacgacgagagcgcccgccccctgacgagc
ccgtcgacgaagaagctcgcgcgcgagtcgggcgtcgacctgcgcgacgtgcacgggaca
ggcgatcacggccggatcacccgcgacgacgtgatgcgcgcggcgcacggcgcgtcggcc
gagccggcgccccagccgagcgcggcggcccagccggcgagcgcggccgcggagctatcg
cagctcatccaggcgagcggcgggttcgtgccgccggtgcccggcgtcgggtacggcgcg
tacaaggtgccgccctactccccgaagcccggcgacaaggtggtgcccttcagccggcgc
cgccgcatcaccgccgaccacatggtctattccaaggtgacgtcgccgcacgtggtgacg
gtcgccgaggtcgacctgcacgagacgtcgaagctgcgcgacctccacaaggacgagttc
aagcgggcgggcgtgtcgctgacgttcctgtccttcatctgcgccgcggccgtgcgcgcg
ctgcgcgagcacccggagttcaacgctcgagtgctcgagaactcgtacgtggtgctgcgc
gacgtcaacctcggcgtggcggtggacacgcccggcggcctcatcgtcccgagcatcaag
cacgcggacgagctgtcgctgcggggcatcgcgaggagcatcgacgagctggccgggcgc
gcgaagtccggcaagatcacggccgacgatctcgcgaacacgaccttcacggtctcgaac
cccggcctcaaggggaacctcttcggcggcgcgatcatctcgcagccgaacgtgggcatc
ctccggatgggggagatcaagaagcgcgtcgtggtggtcacgaaggacaaggaggactcg
atcgcgatccatccggtcatgttcctcgcgctgtcgtacgaccaccgcatcatcgacggg
gtgctggcgaactcgttcctctggcgcgtcaccgacatcctcacacgcggggagttcgag
gtatga

DBGET integrated database retrieval system