KEGG   Sorangium cellulosum So ce 56: sce6586Help
Entry
sce6586           CDS       T00634                                 

Gene name
aceF2
Definition
dihydrolipoyllysine-residue acetyltransferase (EC:2.3.1.12)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
scl  Sorangium cellulosum So ce 56
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:scl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    sce6586 (aceF2)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    sce6586 (aceF2)
  Amino acid metabolism
   00310 Lysine degradation
    sce6586 (aceF2)
Enzymes [BR:scl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     sce6586 (aceF2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9160574..9161899
Genome map
AA seq 441 aa AA seqDB search
MVEVRMPQLGESVVEGTVSRWLVREGDFVKREQPLLEVATDKADTEIPAPVAGRVSQIAV
AEGTVVAKEGLLCRIDETAQGEAQATAQRASAPPAPSEARPAAPAPGSNGHDESARPLTS
PSTKKLARESGVDLRDVHGTGDHGRITRDDVMRAAHGASAEPAPQPSAAAQPASAAAELS
QLIQASGGFVPPVPGVGYGAYKVPPYSPKPGDKVVPFSRRRRITADHMVYSKVTSPHVVT
VAEVDLHETSKLRDLHKDEFKRAGVSLTFLSFICAAAVRALREHPEFNARVLENSYVVLR
DVNLGVAVDTPGGLIVPSIKHADELSLRGIARSIDELAGRAKSGKITADDLANTTFTVSN
PGLKGNLFGGAIISQPNVGILRMGEIKKRVVVVTKDKEDSIAIHPVMFLALSYDHRIIDG
VLANSFLWRVTDILTRGEFEV
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaagtccgcatgccacagctcggtgagagcgtggtcgagggaaccgtctcgagg
tggctcgtgcgcgagggcgatttcgtcaagcgcgagcagccgctgctcgaggtcgcgacc
gacaaggccgatacggagatcccggcgcccgtcgcgggtcgtgtctcgcagatcgcggtg
gccgagggcaccgtcgtcgccaaggaaggtctgctctgtcggatcgacgagacggcgcag
ggcgaggcccaggcgacggcccagcgcgcgagcgcgccgccggcgccgtccgaagcgcgg
cccgccgcgccggcgcccggcagcaacggacacgacgagagcgcccgccccctgacgagc
ccgtcgacgaagaagctcgcgcgcgagtcgggcgtcgacctgcgcgacgtgcacgggaca
ggcgatcacggccggatcacccgcgacgacgtgatgcgcgcggcgcacggcgcgtcggcc
gagccggcgccccagccgagcgcggcggcccagccggcgagcgcggccgcggagctatcg
cagctcatccaggcgagcggcgggttcgtgccgccggtgcccggcgtcgggtacggcgcg
tacaaggtgccgccctactccccgaagcccggcgacaaggtggtgcccttcagccggcgc
cgccgcatcaccgccgaccacatggtctattccaaggtgacgtcgccgcacgtggtgacg
gtcgccgaggtcgacctgcacgagacgtcgaagctgcgcgacctccacaaggacgagttc
aagcgggcgggcgtgtcgctgacgttcctgtccttcatctgcgccgcggccgtgcgcgcg
ctgcgcgagcacccggagttcaacgctcgagtgctcgagaactcgtacgtggtgctgcgc
gacgtcaacctcggcgtggcggtggacacgcccggcggcctcatcgtcccgagcatcaag
cacgcggacgagctgtcgctgcggggcatcgcgaggagcatcgacgagctggccgggcgc
gcgaagtccggcaagatcacggccgacgatctcgcgaacacgaccttcacggtctcgaac
cccggcctcaaggggaacctcttcggcggcgcgatcatctcgcagccgaacgtgggcatc
ctccggatgggggagatcaagaagcgcgtcgtggtggtcacgaaggacaaggaggactcg
atcgcgatccatccggtcatgttcctcgcgctgtcgtacgaccaccgcatcatcgacggg
gtgctggcgaactcgttcctctggcgcgtcaccgacatcctcacacgcggggagttcgag
gtatga

DBGET integrated database retrieval system