KEGG   Sorangium cellulosum So ce 56: sce7105Help
Entry
sce7105           CDS       T00634                                 

Gene name
pcaF
Definition
(GenBank) Putative beta-ketoadipyl CoA thiolase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
scl  Sorangium cellulosum So ce 56
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:scl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    sce7105 (pcaF)
   00630 Glyoxylate and dicarboxylate metabolism
    sce7105 (pcaF)
   00640 Propanoate metabolism
    sce7105 (pcaF)
   00650 Butanoate metabolism
    sce7105 (pcaF)
  Lipid metabolism
   00071 Fatty acid degradation
    sce7105 (pcaF)
   00072 Synthesis and degradation of ketone bodies
    sce7105 (pcaF)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    sce7105 (pcaF)
   00310 Lysine degradation
    sce7105 (pcaF)
   00380 Tryptophan metabolism
    sce7105 (pcaF)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    sce7105 (pcaF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    sce7105 (pcaF)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    sce7105 (pcaF)
Enzymes [BR:scl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     sce7105 (pcaF)
Exosome [BR:scl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   sce7105 (pcaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
9904196..9905380
Genome map
AA seq 394 aa AA seqDB search
MTLPVPVYIVAAARTPIGAFQGALSPLPAPRLGEVAIRAALERAKLSPEAVEEVFLGNVL
SAGIGQAPARQAAIFAGIPSKVPATTVSKVCGSGLQAVIFGAKTVALGDADVVVAGGMES
MSNVPYYLPQARSGYRMGDGKLVDGMIHDGLWDPYGNFHMGTAGDACAREHGFSREAQDE
YAKESFRRAVAAQREGLFAAEIAPVSVPQKKGDAVIVKDDEGPPAGKPEKFASLKPAFQK
DGTITAANASSINDGASALVLASERAVKEHKLTPLARIVGYGGAAQAPEWFTTAPAAAIA
NTTKKLGIPTDQIDLFEVNEAFAVVALAVNKLSGLDAQKVNVRGGAVALGHPIGASGARI
LTTLLFAMKDRNAKRGLATLCIGGGEALAVVVER
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgcccgtccccgtgtacatcgtcgcagcggcccggacgccgatcggcgcgttc
cagggcgcactctcgcccttgcccgccccccgcctgggtgaggtcgccatccgggcggcg
ctcgagcgggcaaagctgtctccggaggccgtcgaggaggtgttcctcggcaatgtcctg
tccgccggtatcgggcaggctccggcccggcaggccgccatcttcgccggcatcccgagc
aaggtgccggccaccaccgtgagcaaggtctgcggctcgggcctccaggccgtcatcttc
ggcgcgaagacggtggcgctcggcgacgcggacgtcgtcgtcgccggcggcatggagtcg
atgtcgaacgtgccctactacctcccgcaggcgcgctccggctaccgcatgggcgacggc
aagctcgtggacggcatgatccacgatggcctgtgggatccgtacggcaactttcacatg
ggcaccgcgggcgacgcgtgcgccagggagcacggcttctcgcgggaggcgcaggacgag
tacgcgaaggagagcttccgccgcgcggtcgcggcccagcgcgaggggctcttcgccgcg
gagatcgcgcccgtctccgtcccgcagaagaagggcgacgccgtgatcgtgaaggacgac
gagggcccgcctgccggcaagcccgagaagttcgcgtccctgaagcccgcgttccagaag
gacgggacgatcaccgcggccaacgcgtcgtcgatcaacgacggcgccagcgcgctcgtg
ctggcgagcgagcgggccgtcaaggagcacaagctcacgccgctcgcgcggatcgtcggc
tatggcggcgccgcgcaggcgcccgagtggttcacgacggcgccggccgcggccatcgcg
aacaccacgaagaagctcggcatcccgacggaccagatcgacctcttcgaggtgaacgag
gcgttcgcggtggtggcgctcgcggtgaacaagctctccgggctcgacgcccagaaggtc
aacgtccgcggcggcgcggtcgcgctcggccacccgatcggcgcgagcggggcgcgcatc
ctgacgacgctgctcttcgccatgaaggaccggaacgcgaagcgcggcctggccacgctc
tgcatcggcggcggcgaggcgctcgcggtcgtcgtggagcggtga

DBGET integrated database retrieval system