KEGG   Sorangium cellulosum So ce 56: sce7131Help
Entry
sce7131           CDS       T00634                                 

Gene name
fpgX
Definition
DNA-formamidopyrimidine glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
scl  Sorangium cellulosum So ce 56
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:scl03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(9943648..9944520)
Genome map
AA seq 290 aa AA seqDB search
MPERPDLEYVVPILARELAGAAVAAARAENSVVLHVLLPERLDALLPGAEIRRVARRAHA
VVFELDGARALDLVISPMLAGRFSITRPGETRIPTDLAFSLTLGDGRELRVRDDVQMSKV
YVLARGDFDRLPGLQRVGLDVLDPRVFTQEAFRSAARGRRDLAKDFLMDGTALDSMGDSY
ADEVLFEARIHPKATVQSLSEEETDRLHAAIARVLGDATRTIARRAPALDERLRDFLKVR
GRPGQPCPRCGDKLRRASVHGHDAIFCPACQPEARRSAAGDPRRARREPG
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgagcgcccggacctggagtacgtcgttccgatcctcgcgcgcgagctcgcgggc
gcggccgtggccgcggcgcgcgccgagaactcggtggtgctgcacgtcctgctcccggag
cgcctcgacgcgctcttgccgggcgcggagatccggcgcgtggcgcggcgggcgcacgcc
gtggtcttcgagctcgacggggcgcgcgcgctcgatctcgtgatctccccgatgctggca
gggcggttctcgatcacgcggccaggagagacgcggattccaaccgatctcgccttctcg
ctgaccctcggggacggccgcgagctcagggtccgagacgacgtgcagatgagcaaggtc
tacgtgctcgcgcggggcgatttcgacaggctccccgggctccagcgcgtcggcctcgac
gtcctcgatcctcgggtgttcacgcaggaggcgtttcgctccgcggcgcgcgggcggcgc
gacctcgccaaggatttcctgatggacgggacggcgctcgactccatgggagactcgtac
gccgacgaggtgctcttcgaggcaaggatccacccgaaggcgacggtccagagcctctcc
gaggaggagaccgaccgcctgcacgcggcgatcgcccgtgtcctcggcgacgcgacccgg
acgatcgcccggcgcgcgccggcgctggacgagcggctgcgcgacttcctcaaggtccgc
gggcgtccgggccagccgtgcccgcgctgcggcgacaagctccgtcgcgcgagcgtccac
gggcacgacgcgatcttctgcccggcctgtcagccggaggcgcggcggagcgcagcgggg
gatccgcgccgcgctaggcgggagccgggctga

DBGET integrated database retrieval system