KEGG   Sorangium cellulosum So ce 56: sce7238Help
Entry
sce7238           CDS       T00634                                 

Definition
Fatty acid desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
scl  Sorangium cellulosum So ce 56
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:scl01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:scl01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10104029..10105030
Genome map
AA seq 333 aa AA seqDB search
MTGVLDAPSTLEPMTQAPASSPTRVVVPKPGPSLSQIFNVLGIAAIHVGTVVAIVRGATW
KLAALAAATYLVRMFAITAVYHRYFSHRSYKTSRGLQFLLALLGTTATQKGPLWWGGTHR
VHHKYSDTERDVHSPLRKGFWYAHMGWWLGREHEELDLKRIPDFAGFPELRWLDRYHAVG
PIGMIALLLAVGGYDAFLWGYVVSTCALMHGTFTINSLAHVFGSRRYATTDTSRNNFWLA
LITLGEGWHNNHHHYMSSANQGFFWWEIDVSFYILRAMEKLGLIWELRTAPAHVLQRNLI
KEVGERSPLLAPQATNAEPLDAPPLGRPSLGDV
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
gtgacgggcgtgctcgatgctccatccaccttggaacccatgacgcaagcgcctgcatcg
agccctacacgggtcgtcgtaccgaaacctggccccagcctcagccagatcttcaacgtg
ctggggatcgctgcgatccacgtcggcaccgtggtcgccatcgtccgaggtgcgacatgg
aagctcgcggcgctcgccgcggcgacctacctcgtccggatgttcgcgatcacggcggtc
taccaccggtacttctcgcaccgtagctacaagaccagccgcggcctgcaattcctgctc
gcgctgctcggcaccacggcgacgcagaagggcccgctgtggtggggggggacgcaccgc
gtccaccacaagtactcggacaccgagcgcgacgtccacagcccgctccgcaaggggttc
tggtacgcgcacatgggttggtggctcggccgcgagcacgaggagctggacctgaagcgc
atccctgacttcgcgggtttccctgagctccgctggctggaccgctaccacgcggtcggg
ccgatcggcatgatcgcgctgctcttggcggtgggcggctacgacgcgttcctgtggggc
tatgtcgtgtcgacgtgcgcgctcatgcacggcacgttcacgatcaactccctcgcgcac
gtgtttggctcgcggcgctacgcgacgaccgacacgagccgcaacaacttctggctcgcg
ctgatcaccctcggcgagggctggcacaacaaccaccaccactacatgagcagcgcgaac
cagggcttcttctggtgggagatcgacgtcagcttctacatcctgcgcgcgatggagaag
ctcggcctgatctgggagctcaggaccgcgccggcgcacgtgctgcagcggaacctgatc
aaggaggtcggcgagcgttcgccgctcctcgcccctcaggccacgaacgccgagcccctc
gatgccccgccgctgggccggccgagcctcggcgacgtctga

DBGET integrated database retrieval system