KEGG   Sorangium cellulosum So ce 56: sce7348Help
Entry
sce7348           CDS       T00634                                 

Gene name
tpi
Definition
Triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
scl  Sorangium cellulosum So ce 56
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:scl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    sce7348 (tpi)
   01230 Biosynthesis of amino acids
    sce7348 (tpi)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    sce7348 (tpi)
   00051 Fructose and mannose metabolism
    sce7348 (tpi)
   00562 Inositol phosphate metabolism
    sce7348 (tpi)
Enzymes [BR:scl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     sce7348 (tpi)
Exosome [BR:scl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   sce7348 (tpi)
  Exosomal proteins of bladder cancer cells
   sce7348 (tpi)
  Exosomal proteins of melanoma cells
   sce7348 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(10238826..10239659)
Genome map
AA seq 277 aa AA seqDB search
MNDGGTSAEAGAAPRAASRRPLIAGNWKMNAGGQDACPLSAAVAKATRELTRAEVVVAPP
FTAIAAVAHELAEAKSEVGIAAQNMSAEVSGAFTGEVSSGMLKDAGATWVILGHSERRQL
FAETDESVARKVASAMAAELRPIVCVGETLEQREAGETLAVVERQVRAVLDELAKQPGFG
VIAYEPVWAIGTGKVARAEDAQEVHAFIRGLLAKASEDLAGVTRILYGGSVKADNAEALL
AQDDIDGALVGGASLDAAGFAKIVDAAHRLAERAEQG
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgatgggggcacgtccgcggaggcgggcgccgccccgcgggcggcctcgcgtcgt
ccgctcatcgccggcaactggaagatgaacgccgggggccaggacgcatgtcctctctcg
gcggccgtcgccaaggcgacgcgcgagctcacccgggccgaggtggtggtcgctccgccg
ttcacggcgatcgccgccgtggcccacgagctcgcggaggcgaagagcgaggtcggcatc
gccgcgcagaacatgagcgccgaggtctccggggcgttcaccggcgaggtctcctcgggc
atgctcaaggacgcgggcgcgacctgggtgatcctcgggcacagcgagcggcggcagctg
ttcgccgagaccgacgagtcggtcgcccggaaggtcgcctcggcgatggccgccgagctg
cgccccatcgtctgcgtcggcgagacgctcgagcagcgcgaggcgggtgagacgctcgcc
gtggtcgagcggcaggtccgcgccgtcctcgacgagctcgcgaagcagcccggcttcggc
gtcatcgcctacgagccggtctgggccatcgggacgggcaaggtcgcgcgcgccgaggac
gcccaggaggtgcacgcgttcatccgcggcctgctcgcgaaggcctcggaggacctcgcg
ggcgtcacgcgcatcctctacggcggcagcgtcaaggccgacaacgccgaggcgctgctc
gcccaggacgatatcgacggcgcgctggtcggcggggcttcgctcgacgccgctggcttc
gccaagatcgtcgacgccgctcaccgactggcggagcgcgcggaacaggggtag

DBGET integrated database retrieval system