KEGG   Sorangium cellulosum So ce 56: sce7434Help
Entry
sce7434           CDS       T00634                                 

Definition
hypothetical protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
scl  Sorangium cellulosum So ce 56
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10359023..10360420
Genome map
AA seq 465 aa AA seqDB search
MTLRSLGRALAALTAFLVLTLVLARPARAKGSSVDERLAKVLARHGFTGEIESTLESRLG
RKLDKKLAKLGRDLFFDSLLGLNDDNSCSGCHAPTAGFADTQSIAIGIDSNGVVGPHRTG
PRNQRRTPTIINTAFYPALMWNSRFFAVSGDPFDNSRGFSFTAPEGTSLSSLPHLLNAQA
FIPPTEVAEMTGYEGPPSHDVVREEVTERVNDVKAYRKRFAKSFQAVKRGDDITYEMIAA
AIAEFEMSLTFADAPIDRFARGRRHAMTLEQKRGALLFFGEAGCVRCHAVSGESNEMFSD
FQQHAIGVPQIAPTDDPAHSNVVFDGPNADEDFGLEQVTGDPADRYKFRTSPLRNVALQP
TFFHNGSFTSLEGAIRHHLDVYTSATEYTNKHLDRDLRGEMGPLAPVLAAVDPLLQEPID
LTEEEISWLCAFVGEALLDPRATPKRLEALIPEELPSGREVHRFE
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgcgatccctcgggcgcgcgctcgccgccctgacggcctttctcgtcctcacg
ctcgtcctggcgcgaccggcgcgcgccaagggctcttccgtcgatgagcggctcgccaag
gtgctcgcccgacacgggttcaccggagagatcgagtcgacgctggagtcgcggctcggg
cggaagctcgacaagaagctcgcgaagctcgggcgtgacctcttcttcgacagcctcctc
ggcctgaacgacgacaactcgtgctcaggctgccacgcgccgaccgcgggcttcgccgac
acgcagtcgatcgccatcggcatcgacagcaacggcgtcgtcgggccgcaccgcacaggg
ccgcgcaaccagcgccgcacgcccaccatcatcaacacggccttctatcccgcgctgatg
tggaactcgcggttcttcgccgtgtccggcgaccccttcgacaacagccgggggttctcg
ttcaccgcgccggaggggacgtcgctctcttccctgccgcacctgctcaacgcccaggcg
ttcatcccgccgaccgaggtcgccgagatgaccgggtacgaggggccgccatcgcacgat
gtcgtgcgcgaggaggtcaccgagcgcgtgaacgacgtgaaggcgtaccggaagcggttc
gccaagagcttccaggcggtgaagcgaggggacgacatcacttacgagatgatcgcggcc
gccatcgccgagttcgagatgtcgctcacgttcgccgacgcgcccatcgacaggttcgcc
cgcggccgccggcacgcgatgacgctggagcagaagcgcggcgcgctgctcttcttcggc
gaggcggggtgcgtcaggtgccacgcggtgtcgggggagtcgaacgagatgttcagcgac
ttccagcagcacgcgatcggcgtgccgcagatcgcgccgaccgacgacccggcgcactcg
aacgtggtcttcgacggcccgaacgccgatgaggacttcggcctggagcaggtcacgggg
gatccggccgatcggtacaagttcaggacctcgccgctgcgcaacgtcgccctccagccc
acgttcttccacaacggctcgttcacgtcgctggaaggcgccatccgccaccacctcgac
gtctacacgtcggccacggagtacacgaacaagcacctcgatcgcgatctgcggggtgag
atgggcccgctcgcgccggtcctcgccgccgtcgacccgctgctgcaggagccgatcgac
ctcacggaggaggagatcagctggctctgcgccttcgtgggagaggcgctgctcgacccg
cgcgcgacgccgaagcggctcgaggcgctcatcccggaggagctcccgagcgggcgcgag
gtccaccgcttcgagtag

DBGET integrated database retrieval system