KEGG   Sorangium cellulosum So ce 56: sce7570Help
Entry
sce7570           CDS       T00634                                 

Definition
folic acid synthesis protein
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
scl  Sorangium cellulosum So ce 56
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    sce7570
Enzymes [BR:scl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     sce7570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10542649..10543146
Genome map
AA seq 165 aa AA seqDB search
MRSRRHVVIGLGSSVGDRLATLRAAIAALGADPDLDVVLESSRYESPPAGGPPQGDYVNA
AVLVATSLPARQILDRTLAVERSLGRTRPDPVRWGPRTIDLDLLWIEGEVVAEPDLEVPH
PRLCDRVFALRPLLDVAPDARDPRTAVAYAALPEASAPIRKLAPI
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgagatcccgccggcatgtcgtcatcgggctcgggtcgagcgtgggcgatcgcctggcg
accctccgcgccgccatcgcggcgctcggcgctgatcccgatctcgacgtcgtcctcgag
tcgtcgcgctacgagtccccgcccgcaggcggccctccgcagggcgactacgtgaacgcc
gcggtgctcgtcgccacgtcgctgcccgcgcgccagatcctcgatcgcaccctcgccgtg
gagcgctcgctcgggcggacgcgccccgatccggtgcgatgggggccgcgcacgatcgat
ctggacctgctctggatcgagggcgaggtcgtcgcggagccggatctcgaggtgcctcac
ccgcggctctgcgaccgtgtgttcgcgctcaggccgctgctcgacgtcgcccccgacgcg
cgcgaccctcgcacggccgtcgcgtacgccgcgctccccgaggcgagcgcgcccattcgc
aagctcgctccgatctga

DBGET integrated database retrieval system