KEGG   Sorangium cellulosum So ce 56: sce7608Help
Entry
sce7608           CDS       T00634                                 

Definition
hypothetical protein
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
scl  Sorangium cellulosum So ce 56
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:scl00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    sce7608
Enzymes [BR:scl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     sce7608
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(10586898..10588979)
Genome map
AA seq 693 aa AA seqDB search
MDIGGKLVPLYAGSVHYWRLDPQHWRACLEATRSLGVHLIDIYVPWAVHETGPGQFDFGR
LDPRRDVGAFLRLAHELGFYVIARPGPHINAELTCFGIPERVIWDPSCQARSARNNPVVL
PMLPYGFPVPSYASNAFHDEVARYFNALAPVLKPHLYPDGPIVLLQIDNEGALYFRDGAY
DQDYHPDAISLYRDFLREKYRTIEALQRAYAPRRVEPAPEGDATEDVGAALVRAIARERA
QAEEGDLRFATITPPVAFDAETPADLARHLDWSEFHEHLLETAMGRFARALSAAGVDGLP
TMHNFPMGQDATPLNPARISRVVDLVGLDYYSIASPSSRQILARRTSELAVRCEALSLPP
FACEMGAGFPPFFPPLEERDSVFVMMAALAYGLRGYNIYMAVERDRWIGAPIDPRGRPRP
FAAFWRRLSAALEATRFHELRRPAPVRIVTPRTERRLSRVMHAFGPLTGAFFSIMNFGAR
DRCLEDDLGLGYPLAVESDTFVRAFEEALDARGVPYAHVGGEDRDISLAGARWVICATSG
GLSPELFAWLEATSRQGTLITLGPREPTFDGAFRQLPRPYDLKRLLAPGQNLPALLQDDP
AAADAAVSRAIDALGLPAFACDPDSVFATLHEDASGTPRVLFLLNPGDADVVARVTVSAQ
RARDVLDDAHFEARRGALEVRLVPRSVRMLALE
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
ctggacatcggcggcaagctggtcccgctgtacgccggcagcgtgcactactggcggctc
gacccgcagcactggcgcgcttgcctcgaggccacgcgctcgctcggcgttcacctgatc
gacatctatgtgccgtgggccgttcacgagaccggcccggggcagttcgatttcggccgg
ctcgatccgcgccgcgacgtcggcgcctttctccgcctcgcgcacgagctcggcttctac
gtcatcgcccgcccgggcccgcacatcaacgcggagctcacctgcttcggcatccccgag
cgcgtcatctgggacccgagctgccaggcccgctcggcgcgcaacaacccggtcgtgctc
ccgatgttgccgtacgggttcccggtcccgagctacgcgagcaacgcattccacgacgag
gtcgcccgctatttcaacgcgctcgccccggtcctgaagccgcacctctacccggacggg
cccatcgtgctcttgcagatcgacaacgagggcgcgctctacttccgcgacggggcgtac
gaccaggattaccacccggacgcgatctccctgtaccgcgacttcttgcgcgagaagtac
cggacgatcgaggcgctccagcgcgcgtatgcgccgaggagggtggagcccgcgccggag
ggcgacgcgaccgaggacgtcggcgcggcgctcgtgcgcgcgatcgcccgcgagcgcgcg
caggccgaggagggcgatctgcggttcgccacgatcacgccgccggtcgcgttcgacgcc
gagacgccggccgatctcgcgcgccacctcgactggagcgagttccacgagcacctcctc
gagaccgccatggggcgcttcgcgagggcgctctccgcggcgggcgtcgatggcctgccc
acgatgcacaatttcccgatgggacaggacgcgacgccgctcaacccggcgcgcatctcg
cgcgtcgtcgacctcgtcggcctcgactactacagcatcgcgagcccgagcagccggcag
atcctcgcccgccggacgagcgagctcgccgtgcgctgcgaggcgctctcgctgccgccg
ttcgcgtgcgagatgggcgccggcttcccgccgttcttcccgccgctcgaggagcgcgac
agcgtgttcgtgatgatggccgcgctcgcgtacgggctgcgcgggtacaacatctacatg
gcggtcgagcgcgaccgctggatcggcgcgccgatcgatccgcgcggccgccctcgcccc
ttcgccgccttctggcggaggctctccgcggccctcgaggcgacgaggttccacgagctc
cgccgcccggcgccggtgcgcatcgtcacgccgcgcacggagcgccggctctcccgcgtg
atgcacgccttcggcccgctcaccggggcgttcttctcgatcatgaacttcggcgcccgc
gatcgctgcctcgaggacgacctcgggctcggttacccgctcgcggtggagtccgacaca
ttcgtgcgtgcgttcgaggaggcgctcgacgcgcgcggcgtcccctacgcccacgtcggc
ggcgaggatcgcgacatctcgctcgccggggcgcgctgggtcatctgcgccacctcgggc
ggcctgagcccggagctgttcgcgtggctggaggcgacgtcccggcaggggacgctgatc
acgctcggcccccgcgagcccaccttcgacggcgccttccgccagctgccgcggccctac
gatctgaagcggctcctcgcccccgggcagaacctgccggcgctcctccaggacgacccc
gccgcggccgacgccgcggtgtcgcgcgccatcgacgcgctcggcctgccggccttcgcg
tgtgatcccgacagtgtctttgcgacgctgcacgaggacgcgtcgggcacgccgcgggtg
ctcttcttgctgaaccccggagacgccgacgtggtggcgcgcgtcaccgtgagcgcccag
cgcgcgcgcgatgtgctggacgacgcgcacttcgaggcgcggcgcggggcgctcgaggtg
cggctcgtgcctcgctccgtgcggatgctcgcgctggagtag

DBGET integrated database retrieval system