KEGG   Sorangium cellulosum So ce 56: sce7617Help
Entry
sce7617           CDS       T00634                                 

Gene name
glpK
Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
scl  Sorangium cellulosum So ce 56
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scl00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    sce7617 (glpK)
Enzymes [BR:scl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     sce7617 (glpK)
Exosome [BR:scl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   sce7617 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10601731..10603299
Genome map
AA seq 522 aa AA seqDB search
MEAPPGTAMRPHAAALVGRMDSAYLLAIDQGTTGTTSLLMDTSGATLGRATREFRQHFPE
PGLVEHDPEEIWQSVQDAVGETLRAAGVAGSAIKAIGITNQRETTLVWERATGRPIHRAI
VWQDRRTAARCAELRAAGHEQAVEETTGLVLDPYFSGTKLAWILDNVPGARARAERGELC
FGTIDSFLVWRLSGDAAGGSPVHATDVTNASRTLLMGLASLSWDDAMLAMLQIPRSLLPQ
IVGSAGRIAATRGFPHLPDGIPIAGIAGDQQAALFGQACFATGDAKCTYGTGAFVLANIG
DRPLRSRFGLLTSVGWKIGSEVVFALEGSAFIAGAAVQWLRDGLGLIKSAAEIEALARSV
PSSEGVTFVPALSGLGAPYWDPDARGIISGVTRGTTAAHLARATLEGIALSVTDLVRAMA
DDLGHPLRRMRVDGGAAANDLLMQFQADVANVAIERPTDLETTARGAAMLAGVGAGLFLT
KEDAARMSRVGQSFQVEMSEAARSAHLHRWADAVARTRAKRS
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgccgcctggaacggctatgcgcccacatgccgccgcgttagtcggccgcatg
gattccgcgtacctcctcgcgatcgatcagggcaccaccggaacgacgtctctcctcatg
gacacgtcgggcgcgacgctgggccgcgcgacgcgcgaatttcgccagcacttcccggag
ccggggctcgtcgagcacgacccggaggagatctggcagagcgttcaggacgccgtgggc
gagacgctcagggcggcgggcgtggccggcagcgcgatcaaggccatcggcatcacgaac
cagcgcgagacgacgctcgtctgggagcgcgcgaccgggcgcccgatccaccgcgcgatc
gtgtggcaggaccgccgcacggcggcgcgctgcgccgagctccgcgccgcgggccacgag
caggcggtcgaggagaccaccggcctcgtgctcgatccgtacttcagcggcacgaagctc
gcgtggatcctcgacaacgtgcccggcgcgcgcgcgcgcgccgagcgcggcgagctctgc
ttcggcaccatcgacagcttcctcgtctggcggctctcgggcgacgcggccggcggctcg
ccggtgcacgcgaccgacgtcaccaacgcgtcgcgcaccctgctcatgggcctcgcgtcg
ctgagctgggacgacgcgatgctcgcgatgctccagatcccgcgctcgctcttgccgcag
atcgtcggctcggcgggccgcatcgcggcgactcgcggcttcccgcacctgcccgacggc
atcccgatcgccggcatcgcgggcgaccagcaggcggccctcttcggccaggcctgcttc
gcgacgggcgacgcgaagtgcacctatggcaccggcgcgttcgtgctggccaacatcggc
gatcgcccgctcaggagccgcttcggcctgctcacctcggtcgggtggaagatcggctcc
gaggtggtctttgcgctcgaggggagcgcctttatcgccggcgcggcggtgcagtggctc
cgcgacggcctgggcctcatcaagagcgcggcggagatcgaggcgctcgcccgcagcgtg
ccctcgagcgagggcgtcacgttcgtcccggcgctctcgggcctcggcgcgccctactgg
gatccggacgctcgcgggatcatctccggggtgacgcgcggcacgaccgcggcgcacctc
gcccgcgcgacgctcgagggaatcgcgctctccgtgacggatctcgtgcgggccatggcc
gacgacctgggccacccgctgcgccggatgcgcgtggacggcggcgccgccgcgaacgac
ctgctcatgcagttccaggcggacgtggcgaacgtcgctatcgagcgccccaccgacctg
gagacgacggcgcgaggcgcggcgatgctcgccggggtaggcgccggcctcttcctcacg
aaggaggacgcggcccgcatgtcccgtgtggggcagagcttccaggtcgagatgagcgaa
gcggctcgatccgcccacctccaccgctgggccgacgccgtcgcccgcacgcgcgcgaag
cgcagctga

DBGET integrated database retrieval system