KEGG   Sorangium cellulosum So ce 56: sce7624Help
Entry
sce7624           CDS       T00634                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
scl  Sorangium cellulosum So ce 56
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    sce7624 (folP)
Enzymes [BR:scl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     sce7624 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(10610730..10611620)
Genome map
AA seq 296 aa AA seqDB search
MGVLNRTPDSFSDGGRFADEDTALAQIDAMLSEGADMIDIGAESTRPGARPVPDDEQIAR
IGGSVRDAVKRGAVVSIDTTSPAVAARALDDGAAVVNSISLDSAAELGALCARRGASLVL
MHSRGPMSAMAGFSAYPDDAYDDVVADVAREWSSAAARALEAGLPEGELVLDPGLGFAKN
ARQSLELCARMHELCALGFPVLVGPSRKSFLARAAASEAAARGGGEEALLAPPPDRLGGT
VAAAIACAARGAAAVRVHDVRPVRQALDVMRAIERAGAGDRRRPDGPVAQGARADG
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgggggtcctgaaccgcacgccggactcgttctccgacggcggtcgctttgcggatgaa
gatacggctctcgcgcagatcgatgcgatgctctccgagggggcagacatgatcgacatc
ggcgcggagtcgacgcggccgggcgcgcggcccgtgccggatgacgagcagatcgcgcgc
atcggcgggagcgtgcgcgacgcggtgaagaggggagcggtggtctccatcgacacgacc
tctcccgccgtcgcggcgcgcgcgctcgacgatggcgcggccgtggtcaactcgatctcg
ctcgacagcgcggcggagctcggcgcgctctgcgctcggcgcggggcgtcgctcgtgctc
atgcacagccgcggcccgatgtcggcgatggccggcttctccgcgtaccccgacgacgcc
tacgacgacgtcgtggccgacgtggcccgcgagtggtcgagcgccgccgcgcgggcgctc
gaggcaggcttgccggagggcgagctcgtcctcgatccgggcctcggcttcgcgaagaac
gcgcggcagtcgctcgagctgtgcgccaggatgcacgagctctgcgccctcggctttccc
gtgctcgtcgggccgagccgcaagtcgttcctggcgcgcgccgcggcctcggaggccgcg
gcgcggggcggcggcgaggaagcgctgctcgcgccgcccccggaccgcctcggcggcacc
gtcgccgccgcgatcgcgtgcgccgcgcgcggcgccgcggccgtccgtgtccacgatgtc
cgccccgtgcgccaggccctcgacgtgatgcgcgcgatcgagcgcgcgggcgccggcgac
cgtcggcgcccggacggccccgtcgcccagggggcgcgagccgatggttga

DBGET integrated database retrieval system