KEGG   Sorangium cellulosum So ce56: sce7918Help
Entry
sce7918           CDS       T00634                                 

Gene name
recD
Definition
(GenBank) putative exodeoxyribonuclease V
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
scl  Sorangium cellulosum So ce56
Pathway
scl03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:scl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    sce7918 (recD)
Enzymes [BR:scl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     sce7918 (recD)
DNA repair and recombination proteins [BR:scl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     sce7918 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 HHH_4 AAA_19 UvrD_C_2 HHH_5 Viral_helicase1 AAA_11 AAA_22 AAA_16 PIF1 PhoH NTPase_1 HHH_2 AAA_5 ArgK AAA_29 T2SSE Helicase_RecD AAA_28 RsgA_GTPase HHH_3 AAA AAA_23 ABC_tran Zeta_toxin AAA_18 NACHT TsaE cobW DUF2075
Motif
Other DBs
NCBI-ProteinID: CAN98088
UniProt: A9FG52
Position
11037489..11040008
Genome map
AA seq 839 aa AA seqDB search
MRDVLQRRSRPRTRALPPPRRRLHAALVQPSQRSGRPDRAARGAAAPAPTPGPDNAPRHD
DRGERTGGTGGTGERQPGGGGQQKLFSAREVAGNGAATVEGEVVRVTYESESSGFRVLRV
EVTPGAPPEVWVGVFPQVGPGTRVRATGRYERDPKHGEQLKVETLLPIAPATLDGLERYL
GSGMVQGIGPAYAKRIVEAFGTETLEILDRSPERLAEVPGLGQRRAQAVAKAWAAQRAIG
AIMIFLQAHGASPALASRIYKRFGPHAIDIVSRSPYRLALDVWGIGFKTADRIARSIGVR
ADSPERAQAGVLQTLVDLSTRGHTLAARPELAELAAAMLERDAAEVDSAIDALVASGHVR
VETLETGEVAVYPKDLHEAEVRLARRMRSLLGDDEDDAAPEARLVEGVDAAIAAFEAKTQ
VSLAPAQRDAVAQAARNKVLVITGGPGVGKTTIVRAILALFDRARLPVRLAAPTGRAAKR
MSEATGREAVTLHRLLEFDPKQRKFGRQRGRPIEAGAIVVDEASMLDLALADALLQATSD
GARLVLVGDVDQLPSVGPGAVLRDVIASGEVPTVRLTQIFRQAEGSLIVRNAHRIHDGEP
PEGARGPGGEFYVIERIEAEAAADLILHLVTERIGKGFGLDPRRDVQVLTPMHKGEAGAI
TLNARLQAALNPEGPSVTRGARTLRLGDKVMQLRNDYDREVYNGDVGFITDVNTEERKLQ
VRFDDREVSYEEAEIDELTLAYATSIHKSQGSEYPAVIVPILTQHFVMLSRNLIYTAVTR
GKRLVVLVADPRAVSLALAETRREERRTHLAERLRGGAPARAGSARMLEAPLAAGPRLD
NT seq 2520 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcgatgttttgcagcggcgctcgcgtccgcgcacgagggcgttgccgccgccgcgc
cggcggctacatgctgccctcgtgcaaccgtcccagcggagcggccgccccgatcgagcg
gcccggggggcagccgcgccggcgccgacgccggggccggacaacgcgccgcgccacgac
gatcgcggcgagcgcacgggcgggacgggcgggaccggtgagcggcagccgggcggtggg
ggccagcagaagctcttctcggcccgggaggtggcgggcaacggggcggcgacggtcgag
ggagaggtcgtccgcgtcacgtacgagagcgagtcgagcggcttccgggtgctgcgggtg
gaggttacccccggcgccccgccggaggtctgggtcggcgtgttcccgcaggtcgggccg
ggcacgcgcgtgcgcgcgacggggcgctacgagcgcgatcccaagcacggcgagcaactc
aaggtcgagaccctgctgccgatcgcccccgccacgctcgatgggctcgagcgctacctc
gggtccggcatggtgcagggcatcggcccggcgtacgcgaagcggatcgtggaggcgttc
ggcacggagacgctggagatcctcgaccggtcgccggagcggctcgccgaggtccccggg
ctcggccagcggcgcgcgcaggcggtcgcgaaggcgtgggcggcgcagcgggcgatcggg
gccatcatgatcttcctccaggcgcacggcgcctccccggcgctggcgagccgcatctac
aagcggttcggcccccacgcgatcgacatcgtctcccgctccccgtaccggctcgcgctc
gacgtgtggggcatcggcttcaagaccgccgaccggatcgcgcgctcgatcggcgtccgg
gccgactcgccggagcgggcgcaagcgggcgtgctgcagacgctggtcgatctgtcgacg
cgcggccacacgctggcggcgcggccggagctcgcggagctcgcggcggcgatgctcgag
cgcgacgccgccgaggtcgacagcgcgatcgacgcgctcgtggcgagcggccatgtgcgg
gtcgagacgctcgagaccggcgaggtggccgtctacccgaaggacctccacgaggccgag
gtgcggctcgcgcgccggatgcgctccttgctgggcgacgacgaggacgacgcggcgccc
gaggcgcgcctcgtggagggcgtcgacgcggcgatcgccgcgttcgaggcgaagacgcag
gtctcgctggcgcctgcccagcgggacgccgtggcgcaggcggcgcggaacaaggtgctg
gtcatcacgggcggccctggcgtgggcaagacgaccatcgtccgggccatcctggcgctc
ttcgaccgcgcccggctcccggtgcggctcgccgcgcccacgggccgcgccgcgaagcgg
atgagcgaggcgacggggcgggaggccgtcacgctccaccgcctgctggagttcgatccc
aagcagcgcaagttcggccgccagcggggccggccgatcgaggcgggggccatcgtggtc
gacgaggcgtcgatgctcgacctggcgctcgccgacgcgctcctgcaggcgacgtccgac
ggcgcgcgcctcgtgctggtgggcgacgtcgatcagctcccgtcggtggggccgggcgcg
gtgctgcgggacgtgatcgcctccggcgaggtgcccacggtgcggctcacgcagatcttc
cgccaggccgagggcagcctcatcgtccggaacgcgcaccgcatccacgacggcgagccg
ccggagggcgcgcgcgggcccggcggcgagttctacgtgatcgagcggatcgaggccgag
gcggcggcggatctgatcctccacctcgtgacggagcgcatcggcaaggggttcgggctg
gatccgcggcgcgacgtccaggtcctgacgccgatgcacaagggcgaggcgggggcgatc
acgctgaacgcgcggctgcaggcggcgctgaaccccgagggtccgagcgtcacgcgcggc
gcgaggacgttacggctcggcgacaaggtgatgcagctccgcaacgactacgaccgtgag
gtgtacaacggcgacgtcggcttcatcacggacgtgaacaccgaggagcggaagctccag
gtgcgcttcgacgatcgcgaggtcagctacgaggaagcggagatcgacgagctgacgctc
gcgtacgcgacgagcatccacaagagccaggggagcgagtatccggcggtgatcgtgccg
atcctcacccagcatttcgtgatgctgtcgcgcaacctcatctacacggcggtgacgcgc
ggcaagcggctcgtggtgctcgtggcggatccgcgggcggtgtcgctggcgctggcggag
acccgccgtgaggagcgccgcacccacctcgcggagcggctgcgcggcggcgcgccggcg
cgcgctggctcggcgcgcatgctcgaggcccccctcgccgccggcccacgactcgactag

DBGET integrated database retrieval system