KEGG   Sorangium cellulosum So ce 56: sce7927Help
Entry
sce7927           CDS       T00634                                 

Gene name
acs
Definition
(GenBank) Acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
scl  Sorangium cellulosum So ce 56
Pathway
scl00010  Glycolysis / Gluconeogenesis
scl00620  Pyruvate metabolism
scl00640  Propanoate metabolism
scl00680  Methane metabolism
scl01100  Metabolic pathways
scl01110  Biosynthesis of secondary metabolites
scl01120  Microbial metabolism in diverse environments
scl01130  Biosynthesis of antibiotics
scl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:scl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    sce7927 (acs)
   00620 Pyruvate metabolism
    sce7927 (acs)
   00640 Propanoate metabolism
    sce7927 (acs)
  Energy metabolism
   00680 Methane metabolism
    sce7927 (acs)
Enzymes [BR:scl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     sce7927 (acs)
Lipid biosynthesis proteins [BR:scl01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   sce7927 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N Cupin_3 DUF1967
Motif
Other DBs
NCBI-ProteinID: CAN98097
UniProt: A9FG84
Position
11049814..11051781
Genome map
AA seq 655 aa AA seqDB search
MSQDAITSLLKETRRFEPPAEFSRRARVGAQATYEALYRESIEQPDAFWRRETSDLVFRT
PWTTISDWSLPHAKWFLGATLNVTESCLDRHLTTATKNKAAIIWEGEHGATRTLTYAQLH
RETLLLADALKRLGIEKGDRVAIYMGMVPEVAVAMLACARLGAVHTVVFGGFAADALRDR
IHDSQAKLVITQDGAYRRGQVVPLKATVDKALAQPEAKSATRVVVYQHLGKERCEVQMTE
GRDVFWHDLLAGAAPACEPTVVDAEHPLFILYTSGSTGKPKGVLHTTAGYLVGAHVTTKY
VFDLRDDDVYWCTADVGWVTGHSYIVYGPLSNGATCLMYEGAPNFPDWGRFWRLIEKHGV
TILYTAPTAIRAFMRQGDEWPAKSDLSSLRLLGSVGEPINPEAWIWYHRTIGGGRCPIVD
TWWQTETGSIMMTTLPGASFSKPGSTGLPMFGVVPEVVTKDGKPVAAGEGGLLVLKQAWP
SMLRTVWGDDDRFRKQYFSDVEGCYFTGDGARRDEDGYFWVVGRIDDVLNVAGHRIGTAE
IESALVSHPSVAEAAAVGRPDDLKGQALVVFVSLRPGVKAGPELQAKLAEHVAKEIGKFA
RPDAIRFADALPKTRSGKIMRRLLKDVAAGRELTGDTSTLEDLTVMAKLRQQEEE
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaggatgccatcacgtcgttgctcaaggagacgcgccggttcgagccgccggcc
gagttctcgcgtcgtgcgcgcgtcggcgcgcaggcgacctacgaggcgctctaccgcgag
agcatcgagcagccggacgcgttctggcgccgggagacgagcgacctcgtgttccgcacg
ccgtggaccacgatcagcgactggtccctgccgcacgccaagtggttcctcggcgccacc
ctcaacgtcacggagagctgcctcgatcgacacctgacgacggccaccaagaacaaggcc
gccatcatctgggagggcgagcacggcgccacgcgcacgttgacctacgcccagctccac
cgcgagacgctgctgctcgccgacgcgctcaagcggctgggcatcgagaagggggaccgg
gtcgcgatctacatgggcatggtccccgaggtcgccgtggcgatgctcgcctgcgcgcgc
ctcggcgcggtgcacaccgtcgtgttcggcggcttcgccgcggacgcgctccgcgaccgc
atccacgacagccaggccaagctcgtcatcacgcaggacggcgcgtaccggcgcgggcag
gtcgtgccgctgaaggcgaccgtcgacaaggcgctcgcgcagccggaggcgaagagcgcg
acccgcgtcgtcgtgtaccagcacctcggcaaggagcgctgcgaggtgcagatgacggag
ggccgcgacgtcttctggcacgacctgctcgccggggccgccccggcctgcgagccgacg
gtcgtcgacgccgagcacccgctcttcatcctctacacgagcggctcgaccgggaagccc
aagggggtgctccacacgaccgccggctacctggtcggcgcgcacgtcacgacgaagtac
gtcttcgatctgcgcgacgacgacgtctactggtgcaccgccgacgtcggctgggtgacg
ggccacagctacatcgtgtacggcccgctctcgaacggcgcgacgtgcctcatgtacgaa
ggcgccccgaacttccccgactggggccgcttctggaggctgatcgagaagcacggggtc
accatcctctacaccgcccccacggccatccgcgccttcatgcggcagggcgacgagtgg
cccgcgaagagcgatctgtcgagcctcaggctcctcggctcggtcggcgagccgatcaac
cccgaggcgtggatctggtaccaccggaccatcggcggcggccgctgcccgatcgtcgac
acctggtggcagacggagacgggctcgatcatgatgaccacgctgcccggcgcgtcgttc
tcgaagccgggatcgaccgggctgccgatgttcggcgtcgtgcccgaggtcgtgacgaag
gacggcaagcccgtcgcggcgggcgagggcgggctgctcgtcctgaagcaggcgtggccg
tcgatgctgcgcacggtgtggggcgacgacgatcgcttccgtaagcagtacttcagcgac
gtcgagggctgctacttcaccggcgacggcgcgcgccgcgacgaggacggctacttctgg
gtcgtcggccgcatcgacgacgtgctgaacgtggccggccaccgcatcgggacggccgag
atcgagagcgcgctcgtgtctcacccctccgtcgcggaggcggccgcggtcggccgtccg
gacgacctcaagggacaggcgctcgtggtgttcgtctcgctccggccgggggtgaaggcc
gggccggagctccaggcaaagctcgccgagcacgtcgccaaggagatcggcaagttcgcg
cgccccgacgccatccgcttcgcggacgccctgccgaagacccgcagcggcaagatcatg
cgccggctcctgaaggacgtcgccgctggtcgagagctgaccggcgacacctcgacgctc
gaggacctgaccgtcatggcgaagctccgccagcaagaagaggagtga

DBGET integrated database retrieval system