KEGG   Sorangium cellulosum So ce 56: sce8013Help
Entry
sce8013           CDS       T00634                                 

Gene name
dfrA
Definition
dihydrokaempferol 4-reductase (EC:1.1.1.219)
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
scl  Sorangium cellulosum So ce 56
Brite
Enzymes [BR:scl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     sce8013 (dfrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11148716..11149717
Genome map
AA seq 333 aa AA seqDB search
MSRYLVTGATGFLGSHLVTALRGGGHDVVALCRAEAPALAAQGVELRRGDILDAASVRGA
AEGCDGVFHCAGRVSRRREDAEALYRTHVEGTKITLDACRDAGVKRAVIASTSGVVAVSK
DPNDVRDEAAATPIDLIAGWPYYRSKLYAERAALDRSGPGFEVVAVNPSILLGPGDVHGA
STGDIVSFLERRLPFTPAGGLSFVDARDAAQGMALAMDKGRPGERYLLGAANMSLEVFFR
RLARISGVPAPALRLPRSIALAKAGAHLIEQARKRLPFDLPVDPVSAEMGQHFWYLDATK
ARRELGWTPRDPLETLADTVADLRARGVVWPQA
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgagccgctatctcgtcaccggcgcgaccggtttcctgggatcgcacctcgtcacggcg
ctccgtgggggtggccatgacgtggtggcgctctgccgggcagaggcgcccgcgctcgcc
gcgcagggcgtggagctccgccgcggagacatcctcgacgcggcgtcggtgcgcggcgcc
gccgagggctgcgacggggtcttccactgcgccgggcgcgtctcgcggcgccgcgaggac
gccgaggcgctctaccggacgcacgtcgaggggaccaagatcaccctcgacgcctgccgc
gacgcgggggtgaagcgcgcggtgatcgcgagcacgagcggcgtcgtcgcggtcagcaag
gacccgaacgacgtccgcgacgaggcggcggcgacgccgatcgacctcatcgccggctgg
ccctactaccgctcgaagctgtacgccgagcgcgcggcgctcgatcgcagcgggcccggc
ttcgaggtcgtcgccgtcaacccgagcatcctgctcggcccgggcgacgtccacggcgcc
tcgaccggcgacatcgtgagcttcctcgagcgccggctcccgttcacccccgcgggcggc
ctctccttcgtcgacgcccgcgacgcggcccagggcatggcgctggcgatggacaagggc
cgcccgggcgagcgctacctgctcggcgccgccaacatgagcctggaggtcttcttccgc
cgcctcgcgcgcatctcgggcgtcccggcccccgccctgcggctgccgcggagcatcgcg
ctcgcgaaggcgggcgcgcacctcatcgagcaggcgcggaagcggctgccgttcgatctg
ccggtcgatcccgtgtcggccgagatgggccagcacttctggtacctcgacgcgacgaag
gcccggcgcgagctcggctggacgccgcgcgacccgctcgagaccctcgcggacacggtc
gccgatctgcgcgcccgcggcgtggtctggccgcaagcgtag

DBGET integrated database retrieval system