KEGG   Sorangium cellulosum So ce 56: sce8057Help
Entry
sce8057           CDS       T00634                                 

Gene name
algC
Definition
hypothetical protein
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
scl  Sorangium cellulosum So ce 56
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:scl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    sce8057 (algC)
   00030 Pentose phosphate pathway
    sce8057 (algC)
   00051 Fructose and mannose metabolism
    sce8057 (algC)
   00052 Galactose metabolism
    sce8057 (algC)
   00500 Starch and sucrose metabolism
    sce8057 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    sce8057 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    sce8057 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    sce8057 (algC)
Enzymes [BR:scl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     sce8057 (algC)
    5.4.2.8  phosphomannomutase
     sce8057 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(11207065..11208492)
Genome map
AA seq 475 aa AA seqDB search
MKVPRHIFREYDIRGAAERDLTSELARELGAAFALRLGRELAAGAPPRRARPEVAVCRDG
RLSSDRLFSALTDGLLAGGADVISAGVGPTPLLYFAAHHLHADGAIMITASHNPAPDNGF
KLMRGKASFFGEDIQALADLIEQGGADGRSAAAGRGALTEVDLAEDYIAAVRAAARLSGT
DVRFVIDAGNGAAGPLGVRTLEALGFAPDALFCDIDGLFPNHHPDPTVPENLEALRARVL
AIGAALGVAWDGDGDRIGVVDERGEVLWGDKLLLLFARSLLAERPGSAVLGEVKCSETLY
ADIAARGGRPILWKTGHSLIKTKMKEEGALLAGEMSGHMFFADRWFGFDDAIYATVRLLE
IVARARRPLGELLADVPETFATPEIRVDCPDAVKFAVVRRVTEHFRRARPVVDIDGARID
FGGGAWGLCRASNTGPILVLRFEGRSVADRDAARAEVEAVVTAAVRDAVGAAPLP
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcccccgacacatcttccgcgagtacgacatccgcggcgccgccgagcgcgac
ctcacgagcgagctggcgcgcgagctcggcgccgcgttcgccctgcgcctcggccgcgag
ctcgccgcgggggcgcctcctcgccgggctcggccggaggtggcggtctgccgggacggc
cgcctctcgagcgaccggctgttctccgccctcacggacggcctgctcgcgggcggcgcc
gacgtcatctcggcgggggtcgggccgacgccgctgctctacttcgcggcgcaccacctc
cacgccgacggcgcgatcatgatcacggcgagccacaacccggcgccggacaacgggttc
aagctcatgcgcggcaaggcctcgttcttcggcgaggacatccaggcgctcgccgacctc
atcgagcaggggggcgccgacggccggagcgccgcggcggggcggggcgcgctcaccgag
gtcgatctcgcggaggactacatcgcggcggtgcgcgccgcggcccgcctgtccggcacc
gacgtccgcttcgtgatcgacgccggcaacggcgcggccggcccgctcggcgtccggacg
ctcgaggcgctcggcttcgcgccggacgcgctcttctgcgacatcgacggcctcttcccg
aaccaccacccggacccgaccgtgcccgagaacctcgaggcgctccgcgcccgcgtgctc
gcgatcggcgccgcgctcggcgtcgcgtgggacggcgacggcgatcggatcggcgttgtc
gacgagcgcggcgaggtgctctggggggacaagctgctgctccttttcgcgcgctcgctc
ctcgcggagcgccccggctcggccgtgctcggggaggtgaagtgctccgagacgctctac
gccgacatcgccgcgcgcggcgggcgccccatcctctggaagacgggccactcgctcatc
aagaccaagatgaaagaggagggcgccctgctcgccggcgagatgagcgggcacatgttc
ttcgccgatcggtggttcgggttcgacgacgcgatctacgcgacggtccgcctgctcgag
atcgtcgcccgggcgcggcggcccctcggcgagctgctcgccgacgtgccggagaccttc
gccacccccgagatccgcgtcgactgccccgacgccgtgaagttcgcggtcgtccgccgc
gtgaccgagcacttccgccgcgcccgtccggtcgtggacatcgacggcgcgcgcatcgac
ttcggcggcggggcctggggcctctgccgcgcctccaacaccggcccgatcctggtgctg
cggttcgaggggcggtccgtcgcggaccgcgacgcggcccgcgccgaggtcgaggccgtc
gtcaccgccgccgtccgcgacgccgtcggcgccgccccgctcccgtga

DBGET integrated database retrieval system