KEGG   Sorangium cellulosum So ce 56: sce8106Help
Entry
sce8106           CDS       T00634                                 

Gene name
copF
Definition
cation-transporting ATPase (EC:3.6.3.-)
Orthology
K17686  
Cu+-exporting ATPase [EC:3.6.3.54]
Organism
scl  Sorangium cellulosum So ce 56
Brite
Enzymes [BR:scl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.54  Cu+-exporting ATPase
     sce8106 (copF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(11274940..11277417)
Genome map
AA seq 825 aa AA seqDB search
MNHAHHHEHGHAHGHGHPAPADRDRERAKDPVCGMTVSPETVAGRHEHGGRTYFFCSERC
LAKFRAEPEKYAPVQARTEGEPTLDQGITTCPMHPEVRQTGPGTCPSCGMALEPVQPVQP
ATRVEYVCPMHPEVVRTEPGSCPICGMALEPRTVTLEDAPSPELVDMSRRFWVSVPLSLV
VLVLGMSEMIPGQPVQRLLGHWLVWIELALTTPVVLWCGAPFFERGWASIRTRHLNMFTL
IAIGTGAAYAYSVLATLAPGVFPHSVRHGGAVPVYFEAASVIISLVLLGQILELRARSRT
SSALKALLGLAPKTARRLAPDGQEEDVPLEHVQPGDRLRVRPGEKVPVDGEVLEGSSAVD
ESMVTGEPIPVEKTPGARVVGGTVNGTGGFVMRADRVGRDTLLARIVQMVGEAQRSRAPI
QRLADAVAAYFVPAVIAIAALTFVVWLLVGPEPRLSHALVNAVAVLIIACPCALGLATPI
SIMVGTGRGATAGILIKNAEALETFEKVDTLVVDKTGTLTEGKPKLASMATLGDLPPNEI
LRLAASLERGSEHPLATAIVAGALEQELDLLPAEGFRSITGKGVVGTVAGRSVALGNLKL
FEELGIPPDDLPRRAEERRQEGQTAMLVAVDGKAAGIVGVADPVRASTGEAVRLLREEGI
HLIMLTGDSRTTAEAVARKLGIEHVEAEVLPDQKAAVVKRLQAEGRIVAMTGDGINDAPA
LAQAHVGVAMGTGTDVAIESAGITLVRGDLRGLLRARKLSRATMRNIRQNLFFAFVYNAL
GVPVAAGVLYPVLGLLLSPMIASAAMSLSSVSVIGNALRLRRTEL
NT seq 2478 nt NT seq  +upstreamnt  +downstreamnt
atgaaccacgcgcatcaccacgagcacggccacgctcacgggcacggccaccctgctccc
gcggaccgagaccgagagcgggcgaaggatccggtctgcgggatgaccgtctcgcccgag
acggtcgctgggcggcatgagcacggcggtcggacgtacttcttctgcagcgagcgctgc
ctcgccaagttccgtgctgagcccgagaagtacgcgccagtccaggcgaggaccgaagga
gagcccacgctggaccagggcatcaccacgtgcccgatgcaccccgaggtccgacagacc
gggccgggaacgtgcccctcgtgcggaatggccctcgagccggtccagccggtccagccg
gcgacgcgcgtcgagtacgtctgcccgatgcaccccgaggtcgtccgcacggagccgggc
tcctgcccgatctgcgggatggccctcgagccgcgcacggtgacgctcgaggacgcgccg
agcccggagctcgtggacatgtcccggcgcttctgggtgagcgtcccgctgagcctcgtt
gtcctcgtgctggggatgtccgagatgatcccgggccagccggtgcagcgtctccttggc
cactggctcgtgtggatcgagctcgccctcaccacgcccgtggtgctctggtgcggcgct
ccgttcttcgagcgcggctgggcctcgatcaggactcggcacctcaacatgttcaccctg
atcgccatcggcacgggcgccgcctacgcgtacagcgtcctggccacgctggcgcccggc
gtcttcccccactccgtccggcatggcggcgcggtcccggtctacttcgaggccgccagc
gtcatcatctcgctggtgttgctcgggcagatcctcgagctccgcgcccgcagccggacg
agcagcgcgctcaaggccctcctcggcctcgccccgaagaccgccaggcgtctcgcgccg
gacgggcaggaggaggacgtccctctcgagcacgtgcagcccggcgaccggctgcgcgtg
cggcccggcgagaaggtgcccgtcgacggagaggtcctcgaggggagcagcgcggtcgac
gagtcgatggtcacgggcgagcccatcccggtcgagaagacgcccggcgcccgagtggtc
ggcggcaccgtcaatggtacgggcggcttcgtgatgcgggccgatcgcgtcgggcgcgac
accctgctcgcccggatcgtccagatggtgggcgaggcccagcgcagccgcgcccccatc
cagcgcctcgccgatgccgtcgccgcgtacttcgtgcccgccgtgatcgcgattgcggcc
ctgaccttcgtggtctggctgctcgtcgggcccgagcccaggctctcccacgcgctcgtc
aacgcggtggctgtgctcatcatcgcgtgcccgtgcgcgctcggcctcgccacgcccatc
tcgatcatggtcgggacggggcgcggcgcgacggccggtatcctgatcaagaacgccgag
gcgctcgagaccttcgagaaggtcgacacccttgtcgtcgacaagaccggcacgctcacc
gagggcaagccgaagctcgcctccatggcgacgctgggcgacctcccgccgaacgagatc
ctcaggctcgcggcgagcctggagcgcggcagcgagcacccgctcgcgaccgccatcgtc
gccggggccctcgagcaggagctcgatctcctgccggcagaagggttccggtcgatcacg
ggcaagggcgtggtgggcacggtggccgggcgctcggtcgcgctcggcaacctcaagctc
ttcgaggagctcggtatcccgccggacgatctcccgcgccgagccgaggagcgccgacaa
gaaggccagacagcgatgctcgtggcggtggatggcaaggcggccggcatcgtcggcgtg
gccgacccggtgcgcgcctcgaccggcgaggccgtccgtctcctccgcgaggagggcatc
cacctgatcatgctcaccggcgacagccgcacgacggcggaggcggtcgcccggaagctc
ggcatcgagcacgtcgaggccgaggtgttgcccgatcagaaggccgcggtcgtgaagcgc
ctccaggccgagggccgcatcgtggcgatgacgggcgacggtatcaacgatgcgcccgcg
ctcgcgcaggcgcacgtcggcgtcgccatgggcaccgggaccgacgtcgccatcgagagc
gccgggatcacgctcgtgcgcggcgacctccgcgggctgttgcgcgcgcggaagctcagc
cgggcgacgatgcgcaacatccgacagaacctgttctttgcgttcgtctacaacgcgctc
ggcgtaccggtcgcggcgggcgttctctatcccgtcctcgggctgctccttagccccatg
atcgccagcgccgcgatgagcctgagctcggtgtctgtcatcggcaacgccctccggttg
cgtcggaccgagctctga

  All links  
No link information was found.   
DBGET integrated database retrieval system